Vw      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 8 is the monadic transformer that represents LaTeX code. & Bind operator plays as concatenator.  Instances of :           Run a  computation. Write a result. Write anything of  class. Like ", but returns an undefined value. Like ", but returns an undefined value. ;Performs a monadic computation, returning his value in the  monad.  Transform a  modifier in a  modifier.        6 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTU6 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTU610/.-,+*)('&$CDEFGH%23456789:;<=>?@AB#IJK"! LMNOPQRSTU6 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUOVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~. from RGB components. Set page color. ; in header defines the default page color of the document. &Set font color from current position. ; in header defines the default font color of the document. *Restore font color from current position. CAMS-Math package. It allows you to write mathematical expressions. (Write a mathematical expression inline. &Mathematical expressions environment. Like $, but expressions are not numbered.  Superscript.  Subscript. "For all" symbol. Environment for a proof. VWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~XWYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~VKVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Like ,, but taking care with reserved characters.  Delimite between quotes a text. Write a ellipsis. *In header, determines the document class. In header, import a package. "In header, determines page style. A local version of , to use for any page. "In header, especifies the document' s author. "In header, especifies the document' s title. &In header, inserts a date of writing.  If you don',t specify one, it takes the date of export. Starts a new line. Starts a new paragraph. Starts a new page. Writes current date. TeX nice word. LaTeX m nice word. LaTeX m2e nice word.      Generate the appendix. Generate the title page.   Generate the table of contents. !"#$%&'Adds a given text to the page' s footnote. (Underlines a text. )Emphasizes a text. *)Environment for create simple lists. See -. +,-BCreate a list item. Optional argument is used to change its icon.  Example:  item [\"-\"] \"Item content.\" .Left alignment. /Right alignment. 0Center alignment. 1Quote from a text. 2Like 12, but indenting the first line of each paragraph. 34Use 4/ to create an abstract, containing the argument's text. 5A text within the 5! environment has monospaced font 3 and no commands or environments will be executed. 6Like 5#, but it makes visible the spaces. 7An inline version of 5. 8An inline version of 6. 9:;<=>?@ABCDEFG Roman font HMonospaced font I Medium font J Upright font K Slanted font LSans Serif font M Bold font N Italic font OSmall Caps font P Default font QRSTUVWXYZ[\]DCreates an horizontal spaces with length specified by the argument.  See Text.LaTeX.Arguments#Measures to create a correct argument. ^Same as ](, but it ignores start or end of lines. _Vertical version of ]%. Useful to separate two paragraphs. `Same as _(, but it ignores start or end of pages. abLike _', but for lines of the same paragraph.  c and d use b with a predefined argument. cdefghijklmnopqThe q, environment can be used to creates tables. - First argument specifies vertical position:  "c" (center),  "t" (top) and  "b" (bottom).  Example: ["t"]  Second argument specifies table' s format:  "l" (left-aligned text column),  "r" (right-aligned text column),  "c" (center text column),  o (justified text column) and  "|" (vertical line).  Example: "|l|r|"  Third argument refers to table' s content:  t inserts an horizontal line,  u$ inserts a partial horizontal line,  (r) separates columns and  (s) separates rows. rstInsert an horizontal line in a q. u&Insert a partial horizontal line in a q.  Start column  End column vwA matrix version of q. 3 First and second arguments have the same meaning.  The generated q. has the same rows and columns as the matrix.       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw[      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ\]^_`abcdefghijklopqrstuvwmn      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxClass options Class Author's name Document's title Document' s content Output yClass options Class Author's name Document's title A list of imported packages Document' s content Output z Function z6 generate a LaTeX file with the following properties:  Article class.  Font Size: 11pt  A title in the first page.  A4 paper. Author's name Article's title Article' s content Output {Like z#, but it lets you import packages. Author's name Article's title A list of imported packages Document' s content Output |Macro for math articles. Like z, but importing  package. Author's name Article's title Document' s content Output xyz{|xyz{|xyz{|}HaTeX nice word. ~Your HaTeX version. Render  to .  Export the  of a  sequence in a .tex file.  to export. Path of export.   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~}~}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ HaTeX-2.0.1Text.LaTeX.ResultText.LaTeX.MonadText.LaTeX.DefineText.LaTeX.ArgumentsText.LaTeX.PackagesText.LaTeX.CommandsText.LaTeX.Macro Text.LaTeXResulttoResult fromResult resCharsStrLaTeXLaTeXTnlxlxlxanylxwlxanywmlxreslxgenlxungenlxcomm0_comm0comm1comm2comm3comm4comm5comm6comm7comm8comm9comm10comm11comm12envenv2env3ExtendLiftWidthStyleClass ClassOptionPlacementSpecifier ItemOptionTextMarkerWordDateTitleNameColorURLEncodingLanguage letterpapera4papera5paperb5paperexecutivepaper legalpaperfleqnleqno titlepage notitlepage onecolumn twocolumntwosideoneside landscape openrightopenanyarticleprocminimalreportbookslidesplainheadingsemptywidthheightdepth totalheightmmcminchptemexMathTerm PackageOptionPackagedocexscaleifthenmsymmakeidxfontencoT1t1t2At2Bt2Cx2lgrsyntonly syntaxonlyinputencapplemacmacukrlatin1koi8_ruansinewcp1251cp850cp866navucsutf8xtextcomp textdegree textcelsiustexteuroeurosymeurobabelselectlanguagehyperrefpdftexhrefcolorpkg monochrome dvipsnames nodvipsnamesusenamesrgb pagecolorcolor normalcolor==:/=:<=:>=:===~~~=<@>@<=@>=@-||--//@|.|+--+<*>*:amsmathmathequation equation_smash^:!:lim->>sumssums_summsqrootcdotcdotsvdotsddotsoverline overbrace underbracehatgravebaracutemathringcheckdotvecbrevetildeddotwidehat widetildealphabetagammagamma_deltadelta_epsilon varepsilonzetaetathetavarthetatheta_iotakappalambdalambda_munuxixi_varpipi_rhovarrhosigmavarsigmasigma_tauupsilonupsilon_phivarphiphi_chipsipsi_omegaomega_daggerddaggerforallbinomproofLxMatrixTabularstringqtsldots documentclass usepackage pagestyle thispagestyleauthortitledocumentlnbkpfbklnbk_newpage linebreak nolinebreak pagebreak nopagebreakfussysloppyendsen frenchspacinginclude includeonlyinput hyphenationhyptodaytexlatexlatexesectionsection_ sectiontab subsection subsection_ subsectiontab subsubsectionsubsubsection_subsubsectiontab paragraph paragraph_ paragraphtab subparagraph subparagraph_subparagraphtabpartpart_parttabchapterchapter_ chaptertabappendix maketitletableofcontents frontmatter mainmatter backmatterlabelrefpagereffootnote underlineemphitemize enumerate descriptionitem flushleft flushrightcenterquote quotationverseabstractverbatim verbatim_verbverb_figuretablecaption listoffigures listoftables clearpagecleardoublepage newcommand renewcommandprovidecommandnewenvironment ignorespacesignorespacesafterendprovidesPackagetextrmtexttttextmdtextuptextsltextsftextbftextittextsc textnormaltiny scriptsize footnotesizesmall normalsizelargelarge2large3hugehuge2par linespreadhspacehspace_vspacevspace_stretchskipbigskip smallskipmboxmbox_fboxparboxminipagemakeboxframeboxraiseboxprotectphantom cjustifiedcseptabular&//hlinecline multicolumn matrixTabm_simplem_wpkgs m_article m_articlepm_mathhatex hatexVersionrenderexportbase Data.StringIsStringGHC.NumNumGHC.Real Fractional GHC.FloatFloating Data.MonoidMonoidGHC.ShowShowlistOptsinOpinOpComgenOptextchar fromStringdatesepGHC.BaseString