y      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 8 is the monadic transformer that represents LaTeX code. & Bind operator plays as concatenator.  Instances of :           Run a  computation. Write a result. Write anything of  class. Like ", but returns an undefined value. Like ", but returns an undefined value. ;Performs a monadic computation, returning his value in the  monad.  Transform a  modifier in a  modifier.        7 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV7 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV7210/.-,+*)('%DEFGHI&3456789:;<=>?@ABC$JKL#"! MNOPQRSTUV7 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVQWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/ from RGB components. Set page color. ; in header defines the default page color of the document. &Set font color from current position. ; in header defines the default font color of the document. *Restore font color from current position. CAMS-Math package. It allows you to write mathematical expressions. (Write a mathematical expression inline. &Mathematical expressions environment. Like $, but expressions are not numbered. 1Insert normal text in a mathematical expression.  Superscript.  Subscript. "For all" symbol. Environment for a proof. WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~YXZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~WMWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Like ,, but taking care with reserved characters.  Delimite between quotes a text. Write a ellipsis. *In header, determines the document class. In header, import a package. "In header, determines page style. A local version of , to use for any page. "In header, especifies the document' s author. "In header, especifies the document' s title. &In header, inserts a date of writing.  If you don',t specify one, it takes the date of export. #After the preamble, insert document's content with . Starts a new line. Starts a new paragraph. Starts a new page.  Writes current date.  TeX nice word.  LaTeX nice word.  LaTeX2e nice word.   !"Generate the appendix. #Generate the title page. $ Generate the table of contents. %&'()*+Adds a given text to the page' s footnote. ,Underlines a text. -Emphasizes a text. .)Environment for create simple lists. See 1. /-Environment for create enumerated lists. See 1. 0.Environment for create description lists. See 1. 1BCreate a list item. Optional argument is used to change its icon.  Example: ! do item ["-"] ; "Item content." 2Left alignment. 3Right alignment. 4Center alignment. 5Quote from a text. 6Like 52, but indenting the first line of each paragraph. 78Use 8/ to create an abstract, containing the argument's text. 9A text within the 9! environment has monospaced font 3 and no commands or environments will be executed. :Like 9#, but it makes visible the spaces. ;An inline version of 9". Argument must be a single line. <An inline version of :". Argument must be a single line. =>?@ABCDEFGHIJK Roman font LMonospaced font M Medium font N Upright font O Slanted font PSans Serif font Q Bold font R Italic font SSmall Caps font T Default font UVWXYZ[\]^_`LIn preamble, it sets the inter-line spacing. Default line spread factor: 1. aDCreates an horizontal spaces with length specified by the argument.  See Text.LaTeX.Arguments#Measures to create a correct argument. bSame as a(, but it ignores start or end of lines. cVertical version of a%. Useful to separate two paragraphs. dSame as c(, but it ignores start or end of pages. e8Create a space filling the remaining space of the line. [ If there are multiple occurences, stretch factor determines the proportion of each space. fLike c', but for lines of the same paragraph.  g and h use f with a predefined argument. ghimbox( creates a box containing its argument. jCreate an empty box. klmnopq It produces a simple black box. rstuvThe v, environment can be used to creates tables. - First argument specifies vertical position:  "c" (center),  "t" (top) and  "b" (bottom).  Example: ["t"]  Second argument specifies table' s format:  "l" (left-aligned text column),  "r" (right-aligned text column),  "c" (center text column),  t (justified text column) and  "|" (vertical line).  Example: "|l|r|"  Third argument refers to table' s content:  y inserts an horizontal line,  z$ inserts a partial horizontal line,  (w) separates columns and  (x) separates rows. wxyInsert an horizontal line in a v. z&Insert a partial horizontal line in a v.  Start column  End column {|A matrix version of v. 3 First and second arguments have the same meaning.  The generated v. has the same rows and columns as the matrix.       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|_      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqtuvwxyz{|rs      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}Class options Class Author's name Document's title Document' s content Output ~Class options Class Author's name Document's title A list of imported packages Document' s content Output  Function 6 generate a LaTeX file with the following properties:  Article class.  Font Size: 11pt  A title in the first page.  A4 paper. Author's name Article's title Article' s content Output Like #, but it lets you import packages. Author's name Article's title A list of imported packages Document' s content Output Macro for math articles. Like , but importing  package. Author's name Article's title Document' s content Output }~}~}~HaTeX nice word. Your HaTeX version. Render  to .  Export the  of a  sequence in a .tex file.  to export. Path of export.   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ HaTeX-2.1.0Text.LaTeX.ResultText.LaTeX.MonadText.LaTeX.DefineText.LaTeX.ArgumentsText.LaTeX.PackagesText.LaTeX.CommandsText.LaTeX.Macro Text.LaTeXResulttoResult fromResult resCharsStrLaTeXLaTeXTnlxlxlxanylxwlxanywmlxreslxgenlxungenlxcomm0_comm0comm1comm2comm3comm4comm5comm6comm7comm8comm9comm10comm11comm12envenv2env3HeightExtendLiftWidthStyleClass ClassOptionPlacementSpecifier ItemOptionTextMarkerWordDateTitleNameColorURLEncodingLanguage letterpapera4papera5paperb5paperexecutivepaper legalpaperfleqnleqno titlepage notitlepage onecolumn twocolumntwosideoneside landscape openrightopenanyarticleprocminimalreportbookslidesplainheadingsemptywidthheightdepth totalheightmmcminchptemexMathTerm PackageOptionPackagedocexscaleifthenmsymmakeidxfontencoT1t1t2At2Bt2Cx2lgrsyntonly syntaxonlyinputencapplemacmacukrlatin1koi8_ruansinewcp1251cp850cp866navucsutf8xtextcomp textdegree textcelsiustexteuroeurosymeurobabelselectlanguagehyperrefpdftexhrefcolorpkg monochrome dvipsnames nodvipsnamesusenamesrgb pagecolorcolor normalcolorfancyhdrfancy==:/=:<=:>=:===~~~=<@>@<=@>=@-||--//@|.|+--+<*>*:amsmathmathequation equation_smash^:!:lim->>sumssums_summsqrootcdotcdotsvdotsddotsoverline overbrace underbracehatgravebaracutemathringcheckdotvecbrevetildeddotwidehat widetildealphabetagammagamma_deltadelta_epsilon varepsilonzetaetathetavarthetatheta_iotakappalambdalambda_munuxixi_varpipi_rhovarrhosigmavarsigmasigma_tauupsilonupsilon_phivarphiphi_chipsipsi_omegaomega_daggerddaggerforallbinomproofLxMatrixTabularstringqtsldots documentclass usepackage pagestyle thispagestyleauthortitledatedocumentlnbkpfbklnbk_newpage linebreak nolinebreak pagebreak nopagebreakfussysloppyendsen frenchspacinginclude includeonlyinput hyphenationhyptodaytexlatexlatexesectionsection_ sectiontab subsection subsection_ subsectiontab subsubsectionsubsubsection_subsubsectiontab paragraph paragraph_ paragraphtab subparagraph subparagraph_subparagraphtabpartpart_parttabchapterchapter_ chaptertabappendix maketitletableofcontents frontmatter mainmatter backmatterlabelrefpagereffootnote underlineemphitemize enumerate descriptionitem flushleft flushrightcenterquote quotationverseabstractverbatim verbatim_verbverb_figuretablecaption listoffigures listoftables clearpagecleardoublepage newcommand renewcommandprovidecommandnewenvironment ignorespacesignorespacesafterendprovidesPackagetextrmtexttttextmdtextuptextsltextsftextbftextittextsc textnormaltiny scriptsize footnotesizesmall normalsizelargelarge2large3hugehuge2par linespreadhspacehspace_vspacevspace_stretchskipbigskip smallskipmboxmbox_fboxparboxminipagemakeboxframeboxraiseboxruleprotectphantom cjustifiedcseptabular&//hlinecline multicolumn matrixTabm_simplem_wpkgs m_article m_articlepm_mathhatex hatexVersionrenderexportbase Data.StringIsStringGHC.NumNumGHC.Real Fractional GHC.FloatFloating Data.MonoidMonoidGHC.ShowShowlistOptsinOpinOpComgenOptextchar fromStringsepGHC.BaseString