a      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~The state of the LaTeX monad. A  is represented by a .  Transform a  to a .  Transform a  to a . =Set of LaTeX reserved characters, and their safe writings as s.  8 is the monadic transformer that represents LaTeX code. & Bind operator plays as concatenator.  Instances of :           Run a  computation. Write a result. Write anything of  class. Like ", but returns an undefined value. Like ", but returns an undefined value. ;Performs a monadic computation, returning his value in the  monad.  Is equivalent to .  Transform a  modifier in a  modifier.        7 !"#$!Page style for a LaTeX document. %&'()*+,-./0123456789:;<=>?@ABCDEFGHIJEPage numbers on the bottom of the page, at the middle of the footer.  Default style. K8Current chapter and page number at the top of the page. LEmpty page style. MNOPQRSTUV7 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV7210/.-,+*)('%DEFGHI&3456789:;<=>?@ABC$JKL#"! MNOPQRSTUV7 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVQWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/ from RGB components. Set page color. ; in header defines the default page color of the document. &Set font color from current position. ; in header defines the default font color of the document. *Restore font color from current position. CAMS-Math package. It allows you to write mathematical expressions. (Write a mathematical expression inline. &Mathematical expressions environment. Like $, but expressions are not numbered. 1Insert normal text in a mathematical expression.  Superscript.  Subscript. "For all" symbol. Environment for a proof. WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~YXZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~WMWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Like ,, but taking care with reserved characters.  Delimite between quotes a text. Write a ellipsis. ,In preamble, determines the document class. In preamble, import a package. $In preamble, determines page style. A local version of , to use for any page. $In preamble, especifies the document' s author. $In preamble, especifies the document' s title. (In preamble, inserts a date of writing.  If you don',t specify one, it takes the date of export. #After the preamble, insert document's content with . Starts a new line. Starts a new paragraph. Starts a new page.  Writes current date.  TeX nice word.  LaTeX nice word.  LaTeX2e nice word.   !"Generate the appendix. #Generate the title page. $ Generate the table of contents. %&'()*+Adds a given text to the page' s footnote. ,Underlines a text. -Emphasizes a text. .)Environment for create simple lists. See 1. /-Environment for create enumerated lists. See 1. 0.Environment for create description lists. See 1. 1BCreate a list item. Optional argument is used to change its icon.  Example: ! do item ["-"] ; "Item content." 2Left alignment. 3Right alignment. 4Center alignment. 5Quote from a text. 6Like 52, but indenting the first line of each paragraph. 78Use 8/ to create an abstract, containing the argument's text. 9A text within the 9! environment has monospaced font 3 and no commands or environments will be executed. :Like 9#, but it makes visible the spaces. ;An inline version of 9". Argument must be a single line. <An inline version of :". Argument must be a single line. =>?@ABCDEFGHIJK Roman font LMonospaced font M Medium font N Upright font O Slanted font PSans Serif font Q Bold font R Italic font SSmall Caps font T Default font UVWXYZ[\]^_`LIn preamble, it sets the inter-line spacing. Default line spread factor: 1. aDCreates an horizontal spaces with length specified by the argument.  See Text.LaTeX.Arguments#Measures to create a correct argument. bSame as a(, but it ignores start or end of lines. cVertical version of a%. Useful to separate two paragraphs. dSame as c(, but it ignores start or end of pages. e8Create a space filling the remaining space of the line. [ If there are multiple occurences, stretch factor determines the proportion of each space. fLike c', but for lines of the same paragraph.  g and h use f with a predefined argument. ghimbox( creates a box containing its argument. jCreate an empty box. klmnopq It produces a simple black box. rstuvThe v, environment can be used to creates tables. - First argument specifies vertical position:  "c" (center),  "t" (top) and  "b" (bottom).  Example: ["t"]  Second argument specifies table' s format:  "l" (left-aligned text column),  "r" (right-aligned text column),  "c" (center text column),  t (justified text column) and  "|" (vertical line).  Example: "|l|r|"  Third argument refers to table' s content:  y inserts an horizontal line,  z$ inserts a partial horizontal line,  (w) separates columns and  (x) separates rows. wxyInsert an horizontal line in a v. z&Insert a partial horizontal line in a v.  Start column  End column {|A matrix version of v. 3 First and second arguments have the same meaning.  The generated v. has the same rows and columns as the matrix.       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|_      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqtuvwxyz{|rs      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}Class options Class Author's name Document's title Document' s content Output ~Class options Class Author's name Document's title A list of imported packages Document' s content Output  Function 6 generate a LaTeX file with the following properties:  Article class.  Font Size: 11pt  A title in the first page.  A4 paper. Author's name Article's title Article' s content Output Like #, but it lets you import packages. Author's name Article's title A list of imported packages Document' s content Output Macro for math articles. Like , but importing  package. Author's name Article's title Document' s content Output }~}~}~HaTeX nice word. Your HaTeX version. Render  to .  Export the  of a  sequence in a .tex file.  to export. Path of export.   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ HaTeX-2.1.3Text.LaTeX.ResultText.LaTeX.MonadText.LaTeX.DefineText.LaTeX.ArgumentsText.LaTeX.PackagesText.LaTeX.CommandsText.LaTeX.Macro Text.LaTeXResulttoResult fromResult resCharsStrLaTeXLaTeXTnlxlxlxanylxwlxanywmlxreslxgenlxungenlxcomm0_comm0comm1comm2comm3comm4comm5comm6comm7comm8comm9comm10comm11comm12envenv2env3HeightExtendLiftWidthStyleClass ClassOptionPlacementSpecifier ItemOptionTextMarkerWordDateTitleNameColorURLEncodingLanguage letterpapera4papera5paperb5paperexecutivepaper legalpaperfleqnleqno titlepage notitlepage onecolumn twocolumntwosideoneside landscape openrightopenanyarticleprocminimalreportbookslidesplainheadingsemptywidthheightdepth totalheightmmcminchptemexMathTerm PackageOptionPackagedocexscaleifthenmsymmakeidxfontencoT1t1t2At2Bt2Cx2lgrsyntonly syntaxonlyinputencapplemacmacukrlatin1koi8_ruansinewcp1251cp850cp866navucsutf8xtextcomp textdegree textcelsiustexteuroeurosymeurobabelselectlanguagehyperrefpdftexhrefcolorpkg monochrome dvipsnames nodvipsnamesusenamesrgb pagecolorcolor normalcolorfancyhdrfancy==:/=:<=:>=:===~~~=<@>@<=@>=@-||--//@|.|+--+<*>*:amsmathmathequation equation_smash^:!:lim->>sumssums_summsqrootcdotcdotsvdotsddotsoverline overbrace underbracehatgravebaracutemathringcheckdotvecbrevetildeddotwidehat widetildealphabetagammagamma_deltadelta_epsilon varepsilonzetaetathetavarthetatheta_iotakappalambdalambda_munuxixi_varpipi_rhovarrhosigmavarsigmasigma_tauupsilonupsilon_phivarphiphi_chipsipsi_omegaomega_daggerddaggerforallbinomproofLxMatrixTabularstringqtsldots documentclass usepackage pagestyle thispagestyleauthortitledatedocumentlnbkpfbklnbk_newpage linebreak nolinebreak pagebreak nopagebreakfussysloppyendsen frenchspacinginclude includeonlyinput hyphenationhyptodaytexlatexlatexesectionsection_ sectiontab subsection subsection_ subsectiontab subsubsectionsubsubsection_subsubsectiontab paragraph paragraph_ paragraphtab subparagraph subparagraph_subparagraphtabpartpart_parttabchapterchapter_ chaptertabappendix maketitletableofcontents frontmatter mainmatter backmatterlabelrefpagereffootnote underlineemphitemize enumerate descriptionitem flushleft flushrightcenterquote quotationverseabstractverbatim verbatim_verbverb_figuretablecaption listoffigures listoftables clearpagecleardoublepage newcommand renewcommandprovidecommandnewenvironment ignorespacesignorespacesafterendprovidesPackagetextrmtexttttextmdtextuptextsltextsftextbftextittextsc textnormaltiny scriptsize footnotesizesmall normalsizelargelarge2large3hugehuge2par linespreadhspacehspace_vspacevspace_stretchskipbigskip smallskipmboxmbox_fboxparboxminipagemakeboxframeboxraiseboxruleprotectphantom cjustifiedcseptabular&//hlinecline multicolumn matrixTabm_simplem_wpkgs m_article m_articlepm_mathhatex hatexVersionrenderexport dstring-0.4 Data.DStringDStringbaseGHC.BaseString Data.StringIsStringGHC.NumNumGHC.Real Fractional GHC.FloatFloating Data.MonoidMonoidGHC.ShowShowtransformers-0.2.2.0Control.Monad.Trans.ClassliftlistOptsinOpinOpComgenOptextchar fromStringsep