z       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                                  ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N OPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                             !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                                                                             ! " # $ % & ' ( ) * + ,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   None234=K6Constructs a simple instrument that takes in a tuple of two arguments. They are amplitude and the frequency (in Hz or cycles per second).9mConstructs a drum-like instrument. Drum like instrument has a single argument that signifies an amplitude.*6789:;   !"#$%&'()*+,-./6789:;&6789:;   !"#$%&'()*+,-./None234=K<FConverts a value to the midi-instrument. It's used with the functions , .@<=>0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkl<=>><=>0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklNone234=K ?@ABmnopqr?@AB?@ABmnopqrNone? !"#$%&'()*+,-012345?- !"#$%&'()*+,543210NoneNone 6789:;<=>?@ABNone NoneNone DProduces midi amplitude and frequency as a signal. The signal fades out when nothing is pressed. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another. "monoMsg portamentoTime releaseTimeEProduces midi amplitude and frequency as a signal and holds the last value till the next one is present. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another. holdMsg portamentoTimeFProduces midi amplitude and frequency as a signal. The signal fades out when nothing is pressed. We can specify a channel. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another. -monoMsgn chnNumber portamentoTime releaseTimeG"Produces midi amplitude and frequency as a signal and holds the last value till the next one is present. We can specify a channel. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another. !holdMsgn chnNumber portamentoTimeH-Produces midi amplitude and frequency as a signal. The signal fades out when nothing is pressed. We can specify a programm number and channel. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another. .pgmonoMsg chnNumber portamentoTime releaseTimeI6Produces midi amplitude and frequency as a signal and holds the last value till the next one is present. We can specify a programm number and channel. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another. pgholdMsg portamentoTimeJ,Initialization of the midi control-messages.KBInitializes midi control and get the value in the specified range.LBInitializes midi control and get the value in the range (-1) to 1.MRUnipolar midiCtrl. Initializes midi control and get the value in the range 0 to 1. CDEFGHIstJKLMO/<=>CDEFGHIJKLMO/CDEFGHIJKLM<=> CDEFGHIstJKLM None      N N     NoneNConverts signal to spectrum.OConverts spectrum to signal.P7Applies a transformation to the spectrum of the signal.Q~Scales all frequencies. Usefull for transposition. For example, we can transpose a signal by the given amount of semitones: scaleSpec (semitone 1) asigR+Adds given amount of Hz to all frequencies. addSpec hz asigSScales frequency in semitones.NOPQRSNOPQRSNOPQRSNOPQRSNone TLow-pass filter. lp cutoff resonance sigUHigh-pass filter. hp cutoff resonance sigVBand-pass filter. bp cutoff resonance sigWBand-reject filter. br cutoff resonance sigXAll-pass filter. alp cutoff resonance sigYHigh-pass filter. bhp cutoff sigZLow-pass filter. blp cutoff sig[Band-pass filter. bbp cutoff bandwidth sig\Band-regect filter. bbr cutoff bandwidth sig]Moog's low-pass filter. %mlp centerFrequency qResonance signal^Produces smooth transitions between values in the signals. The first value defines a duration in seconds for a transition from one value to another in piecewise constant signals. TUVWXYZ[\]^ TUVWXYZ[\]^ TUVWXZY[\]^ TUVWXYZ[\]^None24 _?A class for easy way to process the outputs of the instruments.a?A class for easy way to process the outputs of the instruments.cScaling the sound.dA shortcut for mapSig.e Crossfade. cfd coeff sig1 sig2[If coeff equals 0 then we get the first signal and if it equals 1 we get the second signal.fBilinear interpolation for four signals. The signals are placed in the corners of the unit square. The first two signals are the xy coordinates in the square.  cfd4 x y a b c d(0, 0) is for a(1, 0) is for b(1, 1) is for c(0, 1) is for dg5Generic crossfade for n coefficients and n+1 signals. cfds coeffs sigshSpectral crossfade.i!Spectral bilinear crossfade (see cfd4).jGeneric spectral crossfade.k Weighted sum.<_`abcdeufghijkvwxyz{|}~ _`abcdefghijk ab_`cdefghijk:_`abcdeufghijkvwxyz{|}~NonelCreates a midi instrument from sf2 sound font. Midi listens on all channels. It's useful to quickly test a sound font. The second argument is a sustain in seconds. How long it takes for the sound to decay.mCreates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with linear interpolation.nCreates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with cubic interpolation.oCreates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with linear interpolation. Produces mono output.pCreates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with cubic interpolation. Produces mono output.q]Midi looper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.rReads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is linear.sReads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is cubic.tReads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is linear. The output is mono.uReads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is cubic. The output is mono.vXLooper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.w^Reads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is linear.x]Reads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is cubic.ysReads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is linear. The output is mono.zrReads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is cubic. The output is mono.{XLooper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.frequency to midilmnopqrstuvwxyz{lmnopqrstuvwxyz{lmnopqrstuvwxyz{lmnopqrstuvwxyz{None|Sets sample rate and block size setRates sampleRate blockSize}#Sets hardware and software buffers. setBufs hardwareBuf ioBufSets the output to nosound. |}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~|}~|}~ ( !"#$%&'A,-./0123456789:;<=>?@+)*IHGFEDCBSJKOPQRNMLXWVUT_^]\[ZYihgfedcba`pjklmno~}|{zyxwvutsrq |}~ None/Gets an init-rate value from the list by index.8Gets an control/audio-rate value from the list by index.F$%&'()*+,-./0123456789:;<?@ABCDEFGHIJKLMF@AHBCDEFLKJIM<;:98765432,+*)10-./$('%&G? None3E0Represents a values with frequency of occurence.UConstant event stream. It produces the same value (the first argument) all the time. Behaves like  !, but returns an event stream.Fires a single event right now. loadbang = pulseE 02Fires a single true value in the given time ahead.-Fires a single event in the given time ahead.*Makes an event stream from list of events. Behaves like  ", but returns an event stream. Behaves like  #, but returns an event stream.;the sync function but time is measured in beats per minute.2Splits event stream on two streams with predicate.9Splits a toggle event stream on on-events and off-events.Constructs an event stream that contains an infinite repetition values from the given list. When an event happens this function takes the next value from the list, if there is no values left it starts from the beggining of the list.bTurns an event of indices to the event of the values from the list. A value is taken with index.  1range (xMin, xMax) === cycleE [xMin .. pred xMax]>An event stream of the integers taken from the given diapason.5An event stream of the random values in the interval (0, 1).9An event stram of lists of random values in the interval (0, 1)5. The first argument is the length of the each list.Skips elements at random.  randSkip probwhere prob@ is probability of includinng the element in the output stream. Skips elements at random. randSkip probFunIt behaves just like randSkip', but probability depends on the value.When something happens on the given event stream resulting event stream contains an application of some unary function to the given initial value. So the event stream contains the values: '[s0, f s0, f (f s0), f (f (f s0)), ...]ISubstitutes all values in the input stream with the given constant value.uAccumulates a values from the given event stream with binary function. It's a variant of the fold for event streams. appendE z f evt When value a happens with evt2, the resulting event stream contains a value (z f a) and in the next time z equals to this value."A special variant of the function % for the monoids. Initial value is  and binary function is , which belong to the instance of the class .iConstructs an event stream that contains values from the given list which are taken in the random order.Constructs an event stream that contains values from the given list which are taken in the random order. In the list we specify not only values but the frequencies of occurrence. Sum of the frequencies should be equal to one.%This function combines the functions  $ and . We transform the values of the event stream with stateful function that produce not just values but the list of values with frequencies of occurrence. We apply this function to the current state and the value and then at random pick one of the values.Specialization of the function .  every n [a, b, c, ..] evt#constructs a mask that skips first n elements and then produces an event and skips next (a - 1) events, then produces an event and skips next (b - 1) events and so on. It's useful for construction of the percussive beats. For example  every 0 [2] (metroE 2)ktriggers an event on the odd beats. With this function we can create a complex patterns of cyclic events.Filters events with the mask. A mask is a list of ones and zeroes. n'th element from the given list should be included in the resulting stream if the n'th element from the list equals to one or skipped if the element equals to zero. // None234=K,Mixes the scores and plays them in the loop.0Mixes the procedures and plays them in the loop.kInvokes an instrument with first event stream and holds the note until the second event stream is active.VInvokes an instrument with toggle event stream (1 stands for on and 0 stands for off).kInvokes an instrument with first event stream and holds the note until the second event stream is active.FSets the same duration for all events. It's useful with the functions scheds, schedsBy, scheds_. FSets the same duration for all events. It's useful with the functions sched, schedBy, sched_. PTriggers an instrument with an event stream. The event stream contains triples: P(delay_after_event_is_fired, duration_of_the_event, argument_for_the_instrument)It's like the function trig, but delay is set to zero.3An instrument is triggered with event stream and delay time is set to zero (event fires immediately) and duration is set to inifinite time. The note is held while the instrument is producing something. If the instrument is silent for some seconds (specified in the first argument) then it's turned off.kInvokes an instrument with first event stream and holds the note until the second event stream is active.)Triggers a procedure on the event stream.FTriggers a procedure on the event stream. A delay time is set to zero.kInvokes an instrument with first event stream and holds the note until the second event stream is active.IA closure to trigger an instrument inside the body of another instrument.IA closure to trigger an instrument inside the body of another instrument.IA closure to trigger an instrument inside the body of another instrument.26789:;?@AB2?@AB9:;678None6A radio button. It takes a list of values with labels.A matrix of values.URadio button that returns functions. Useful for picking a waveform or type of filter.Matrix of functional values.Shortcut for press S events.Shortcut for release S events.eUnipolar linear slider. The value belongs to the interval [0, 1]. The argument is for initial value.cUnipolar linear knob. The value belongs to the interval [0, 1]. The argument is for initial value.DExponential slider (usefull for exploring frequencies or decibels).  xknob min max initValVThe value belongs to the interval [min, max]. The last argument is for initial value.BExponential knob (usefull for exploring frequencies or decibels).  xknob min max initValVThe value belongs to the interval [min, max]. The last argument is for initial value.Unit linear joystick.The sample and hold widget. You can pick a value from the list of doubles. The original value is a head of the list (the first element). The visual grouping is horizontal (notice the prefix h(). It's common to use it with function selector.The sample and hold widget. You can pick a value from the list of doubles. The original value is a head of the list (the first element). The visual grouping is vertical (notice the prefix v(). It's common to use it with function selector.The matrix of unipolar knobs. (knobPad columnNum rowNum names initVals It takes in the dimensions of matrix, the names (we can leave it empty if names are not important) and list of init values. It returns a function that takes in indices and produces the signal in the corresponding cell.The matrix of toggle buttons. *togglePad columnNum rowNum names initVals It takes in the dimensions of matrix, the names (we can leave it empty if names are not important) and list of init values (on/off booleans). It returns a function that takes in indices and produces the event stream in the corresponding cell.The matrix of buttons.  buttonPad columnNum rowNum namesIt takes in the dimensions of matrix, the names (we can leave it empty if names are not important). It returns a function that takes in indices and produces the event stream in the corresponding cell.A generic constructor for matrixes of sound source widgets. It takes the constructor of the widget, a default initial value, the dimensions of the matrix, the list of names and the list of initial values. It produces the function that maps indices to corresponding values.Horizontal radio group.Vertical radio group.Horizontal radio group.Vertical radio group.PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     Ъ     RPQSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~None246Creates a window with the given name, size and content win name (width, height) guiThe shortcut for  mapSource.wCombines two sound sources. Visuals are aligned horizontally and the sound sources a grouped with the given function. uCombines two sound sources. Visuals are aligned vertically and the sound sources a grouped with the given function. It's just like the hlift2> but two more parameters change visual scaling of the widgets.It's just like the vlift2> but two more parameters change visual scaling of the widgets. The same as hlift2 but for three sound sources. The same as vlift2 but for three sound sources. The same as hlift2' but for three sound sources. The same as vlift2' but for three sound sources. The same as hlift2 but for four sound sources. The same as vlift2 but for four sound sources. The same as hlift2' but for four sound sources. The same as vlift2' but for four sound sources. The same as hlift2 but for five sound sources. The same as vlift2 but for five sound sources. The same as hlift2' but for five sound sources. The same as vlift2' but for five sound sources.PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-.012345,.%None     NOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMlmnopqrstuvwxyz{None24Renders Csound file.0Render Csound file and save it to the give file.=Render Csound file with options and save it to the give file.9Render Csound file and save result sound to the wav-file.FRender Csound file with options and save result sound to the wav-file.qRenders Csound file, saves it to the given file, renders with csound command and plays it with the given program. playCsd program file csd Produces files file.csd (with &') and file.wav (with csound) and then invokes: program "file.wav"Works just like &(# but you can supply csound options.Renders csound code to file tmp.csd and plays it with -odac7 option (sound output goes to soundcard in real time).) with options.)Output to dac with virtual midi keyboard.@Output to dac with virtual midi keyboard with specified options.Renders to file tmp.csd and invokes the csound on it.Renders to file tmp.csd and invokes the csound on it.6Renders to tmp.csd and tmp.wav and plays with mplayer.6Renders to tmp.csd and tmp.wav and plays with mplayer.;Renders to tmp.csd and tmp.wav and plays with totem player.;Renders to tmp.csd and tmp.wav and plays with totem player./. None&Table contains all provided values (table is extended to contain all values and to be of the power of 2 or the power of two plus one). (by default it skips normalization).#Segments of the exponential curves. exps [a, n1, b, n2, c, ...]where  a, b, c, ... are ordinate values n1, n2, ...U are lengths of the segments relative to the total number of the points in the table.Equally spaced segments of exponential curves. eexps [a, b, c, ...] is the same as exps [a, 1, b, 1, c, ...]Segments of cubic polynomials.  cubes [a, n1, b, n2, c, ...]where a, b, c .. - are ordinate values n1, n2, ...U are lengths of the segments relative to the total number of the points in the table-Equally spaced segments of cubic polynomials. ecubes [a, b, c, ...] is the same as cubes [a, 1, b, 1, c, ...]Segments of straight lines.  lins [a, n1, b, n2, c, ...]where a, b, c .. - are ordinate values n1, n2, ...U are lengths of the segments relative to the total number of the points in the table*Equally spaced segments of straight lines. elins [a, b, c, ...] is the same as lins [a, 1, b, 1, c, ...]Cubic spline curve. splines [a, n1, b, n2, c, ...]where a, b, c .. - are ordinate values n1, n2, ...U are lengths of the segments relative to the total number of the points in the tableEqually spaced spline curve. esplines [a, b, c, ...] is the same as splines [a, 1, b, 1, c, ...]$Constant segments (sample and hold). consts [a, n1, b, n2, c, ...]where a, b, c .. - are ordinate values n1, n2, ...U are lengths of the segments relative to the total number of the points in the table!Equally spaced constant segments. econsts [a, b, c, ...] is the same as consts [a, 1, b, 1, c, ...]9Creates a table from a starting value to an ending value. GstartEnds [val1, dur1, type1, val2, dur2, type2, val3, ... typeX, valN],val1, val2 ... -- end points of the segments+dur1, dur2 ... -- durations of the segmentswtype1, type2 ... -- if 0, a straight line is produced. If non-zero, then it creates the following curve, for dur steps: >beg+(end-beg)*(1-exp(i*type))/(1-exp(type * dur))$beg, end - end points of the segmentdur - duration of the segment .Equally spaced interpolation for the function  startEnds )estartEnds [val1, type1, val2, typ2, ...]is the same as 0estartEnds [val1, 1, type1, val2, 1, type2, ...] Series of harmonic partials: sine = sines [1] #saw = sines $ fmap (1 / ) [1 .. 10] )square = sines $ fmap (1 / ) [1, 3 .. 11] Ntriangle = sines $ zipWith (\a b -> a / (b ** 2)) (cycle [1, -1]) [1, 3 .. 11]  Just like  $ but partial strength is set to one.  Just like   but phases are set to zero. 1Specifies series of possibly inharmonic partials.ESpecifies series of possibly inharmonic partials with direct current.Table for pure sine wave.Table for pure cosine wave.Table for sigmoid wave.'Generates values similar to the opcode  *.  Cbuzzes numberOfHarmonics [lowestHarmonic, coefficientOfAttenuation]With buzzes n [l, r] you get n harmonics from l& that are attenuated by the factor of r on each step.SModified Bessel function of the second kind, order 0 (for amplitude modulated FM).   bessels xint,the function is defined within the interval  [0, xint]. Polynomials. polys xl xr [c0, c1, c2, ..]whereNxl, xr - left and right values of the interval over wich polynomial is defined3[c0, c1, c2, ...] -- coefficients of the polynomial c0 + c1 * x + c2 * x * x + ...(Chebyshev polynomials of the first kind. polys xl xr [h0, h1, h2, ..]whereNxl, xr - left and right values of the interval over wich polynomial is defined6[h0, h1, h2, ...] -- relative strength of the partials)Chebyshev polynomials of the second kind. polys xl xr [h0, h1, h2, ..]whereNxl, xr - left and right values of the interval over wich polynomial is defined6[h0, h1, h2, ...] -- relative strength of the partials DCreates a table of doubles (It's f-table in Csound). Arguments are: identificator of the GEN routineGEN routine arguments9All tables are created at 0 and memory is never released.! Adds guard point to the table size (details of the interpolation schemes: you do need guard point if your intention is to read the table once but you don't need the guard point if you read table in many cycles, the guard point is the the first point of your table). " Shortcut for !.#BSets an absolute size value. As you can do it in the Csound files.$OSets the relative size value. You can set the base value in the options (see + at ,, with tabResolution you can easily change table sizes for all your tables). Here zero means the base value. 1 is the base value multiplied by 2, 2 is the base value multiplied by 4 and so on. Negative values mean division by the specified degree. %Sets degrees from -3 to 3.&Sets degrees from -3 to 3.'Sets degrees from -3 to 3.(Sets degrees from -3 to 3.)Sets degrees from -3 to 3.*Sets degrees from -3 to 3.+Sets degrees from -3 to 3.F      !"#$%&'()*+T !"#=>H      !"#$%&'()*+TH#" !      >=#$!"%&'()*+=       !"#$%&'()*+None,Low frequency oscillator-A pure tone (sine wave)..*An oscillator with user provided waveform./LTurns a bipolar sound (ranges from -1 to 1) to unipolar (ranges from 0 to 1)0MTurns an unipolar sound (ranges from 0 to 1) to bipolar (ranges from -1 to 1)1Unipolar pure tone.2 Unipolar -..3Unipolar sawtooth.4Unipolar integrated sawtooth.5Unipolar square wave.6Unipolar triangle wave.7Unipolar pulse.8!Unipolar band-limited oscillator.91Rescaling of the bipolar signal (-1, 1) -> (a, b)  on a b biSig:1Rescaling of the unipolar signal (0, 1) -> (a, b)  on a b uniSig;GConstant random signal. It updates random numbers with given frequency. constRnd freq <ELinear random signal. It updates random numbers with given frequency.  rndi freq = Unipolar rndh> Unipolar rndi? White noise.@ Pink noise.ALow frequency oscillator lfo shape depth rate,-./0123456789:;<=>?@A,-./0123456789:;<=>?@A-./09:12347568;=<>?@,A,-./0123456789:;<=>?@ANone)B+Linear adsr envelope generator with release  leg attack decay sustain releaseC0Exponential adsr envelope generator with release  xeg attack decay sustain releaseD>Makes time intervals relative to the note's duration. So that: onIdur [a, t1, b, t2, c] becomes: [a, t1 * idur, b, t2 * idur, c]E>Makes time intervals relative to the note's duration. So that: onDur dt [a, t1, b, t2, c] becomes: , t1 * dt, b, t2 * dt, c]F The opcode /0B with time intervals relative to the total duration of the note.G The opcode /1B with time intervals relative to the total duration of the note.H The opcode /0T with time intervals relative to the total duration of the note given by the user.I The opcode /1T with time intervals relative to the total duration of the note given by the user.J The opcode /2h with time intervals relative to the total duration of the note. Total time is set to the value of idur. linendur asig rise decayK The opcode /2w with time intervals relative to the total duration of the note. Total time is set to the value of the first argument. linendurBy dt asig rise decayL$Fades in with the given attack time.M%Fades out with the given attack time.N0Fades in by exponent with the given attack time.O1Fades out by exponent with the given attack time.P&A combination of fade in and fade out. "fades attackDuration decayDurationQ2A combination of exponential fade in and fade out. %expFades attackDuration decayDurationS3Sample and hold cyclic signal. It takes the list of [a, dta, b, dtb, c, dtc, ...]4the a, b, c, ... are values of the constant segmentsAthe dta, dtb, dtc, are durations in seconds of constant segments.@The period of the repetition equals to the sum of all durations.TIt's just like linseg but it loops over the envelope.UIt's just like expseg but it loops over the envelope.VNSample and hold sequence. It outputs the looping sequence of constan elements.W&Step sequencer with unipolar triangle.X$Step sequencer with unipolar square.Y&Step sequencer with unipolar sawtooth.Z,Step sequencer with unipolar inveted square.[.Step sequencer with unipolar inveted sawtooth.\2Step sequencer with unipolar exponential sawtooth.];Step sequencer with unipolar inverted exponential sawtooth.^2Step sequencer with unipolar exponential triangle._JLooping sample and hold envelope. The first argument is the list of pairs:  [a, durA, b, durB, c, durc, ...]It's a list of values and durations. The durations are relative to the period of repetition. The period is specified with the second argument. The second argument is the frequency of repetition measured in Hz. lpshold valDurs frequency`JLooping linear segments envelope. The first argument is the list of pairs:  [a, durA, b, durB, c, durc, ...]It's a list of values and durations. The durations are relative to the period of repetition. The period is specified with the second argument. The second argument is the frequency of repetition measured in Hz. loopseg valDurs frequencyaOLooping exponential segments envelope. The first argument is the list of pairs:  [a, durA, b, durB, c, durc, ...]It's a list of values and durations. The durations are relative to the period of repetition. The period is specified with the second argument. The second argument is the frequency of repetition measured in Hz. loopxseg valDurs frequencybWIt's like lpshold but we can specify the phase of repetition (phase belongs to [0, 1]).cWIt's like loopseg but we can specify the phase of repetition (phase belongs to [0, 1]).dXIt's like loopxseg but we can specify the phase of repetition (phase belongs to [0, 1]).eThe looping ADSR envelope. 7xadsrSeq attack decay sustain release weights frequencyVThe sum of attack, decay, sustain and release time durations should be equal to one.fThe looping exponential ADSR envelope. there is a fifth segment at the end of the envelope during which the envelope equals to zero. 7xadsrSeq attack decay sustain release weights frequencyVThe sum of attack, decay, sustain and release time durations should be equal to one.g3The looping ADSR envelope with the rest at the end. ;adsrSeq attack decay sustain release rest weights frequency\The sum of attack, decay, sustain, release and rest time durations should be equal to one.hThe looping exponential ADSR envelope. there is a fifth segment at the end of the envelope during which the envelope equals to zero. =xadsrSeq_ attack decay sustain release rest weights frequency\The sum of attack, decay, sustain, release and rest time durations should be equal to one.i*The looping sequence of constant segments. DlinSeg [a, durA, b, durB, c, durC, ...] [scale1, scale2, scale3] cpsThe first argument is the list that specifies the shape of the looping wave. It's the alternating values and durations of transition from one value to another. The durations are relative to the period. So that lists *[0, 0.5, 1, 0.5, 0] and [0, 50, 1, 50, 0]produce the same results. The second list is the list of scales for subsequent periods. Every value in the period is scaled with values from the second list. The last argument is the rate of repetition (Hz).j(The looping sequence of linear segments. DlinSeg [a, durA, b, durB, c, durC, ...] [scale1, scale2, scale3] cpsThe first argument is the list that specifies the shape of the looping wave. It's the alternating values and durations of transition from one value to another. The durations are relative to the period. So that lists *[0, 0.5, 1, 0.5, 0] and [0, 50, 1, 50, 0]produce the same results. The second list is the list of scales for subsequent periods. Every value in the period is scaled with values from the second list. The last argument is the rate of repetition (Hz).k-The looping sequence of exponential segments. DexpSeg [a, durA, b, durB, c, durC, ...] [scale1, scale2, scale3] cpsThe first argument is the list that specifies the shape of the looping wave. It's the alternating values and durations of transition from one value to another. The durations are relative to the period. So that lists *[0, 0.5, 1, 0.5, 0] and [0, 50, 1, 50, 0]produce the same results. The second list is the list of scales for subsequent periods. Every value in the period is scaled with values from the second list. The last argument is the rate of repetition (Hz).4BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk*BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk*BCDFGJEHIK_`abcdijkTUSRVWXY[\]Z^efghLMPNOQ4BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkNonel#Selects odd elements from the list.m$Selects even elements from the list.n)Reads table once during the note length. o0Reads table once during a given period of time. p3Reads table several times during the note length. q Mean value.rUAdds vibrato to the sound unit. Sound units is a function that takes in a frequency. s^Adds a random vibrato to the sound unit. Sound units is a function that takes in a frequency. t=Chorus takes a number of copies, chorus width and wave shape.uApplies a resonator to the signals. A resonator is a list of band pass filters. A list contains the parameters for the filters: [(centerFrequency, bandWidth)]vA resonator with user defined band pass filter. Warning: a filter takes in a center frequency, band width and the signal. The signal comes last (this order is not standard in the Csound but it's more convinient to use with Haskell).wMixes dry and wet signals.  dryWet ratio effect asigratio - of dry signal to weteffect - means to wet the signalasig -- processed signalx%Chain of mass-spring-damping filters. modes params baseCps exciter params - a list of pairs '(resonantFrequencyRatio, filterQuality)baseCps" - base frequency of the resonator-exciter - an impulse that starts a resonator.y1Doubles the mono signal to get the stereo signal.zRandom panning{Random panning|'Random volume (with gauss distribution) gaussVol radiusOfDistribution} Random volume gaussVol (minVolume, maxVolume)~pHi-fi output for stereo signals. Saves the stereo signal to file. The length of the file is defined in seconds. "writeHifi fileLength fileName asig}It picks a signal from the list by integer index. The original value is taken from the head of the list (the first element).Creates running arpeggios.  +arpeggiBy ampWeights pitches instrument cpsIt plays an instrument with fast sequence of notes. We can specify the pitches and amplitude weights of the notes as well as frequency of repetition.Creates running arpeggios.  =arpeggiBy ampWave pitchwave ampWeights pitches instrument cpsIt plays an instrument with fast sequence of notes. We can specify amplitude envelope wave, pitch envelope wave, the pitches and amplitude weights of the notes as well as frequency of repetition.ZLow-pass filter pictured as joystick. Ox is for center frequency and Oy is for resonance.lmnopqrstuvwxyz{|}~lmnopqrstuvwxyz{|}~qrstuvxwnopylm{z}|~lmnopqrstuvwxyz{|}~None)The sample format.64-bit floats with a header24-bit integers with a header%8-bit unsigned integers with a header32-bit floats with a header32-bit integers with a header 16-bit integers with a headeru-law samples with a headerP16-bit integers with a header. The header type depends on the render (-o) format16-bit integers without header,32-bit floating point samples without headerKTakes only given amount (in seconds) from the signal (the rest is silence).0Delays signals by the given amount (in seconds).{Delays a signal by the first argument and takes only second argument amount of signal (everything is measured in seconds).)Repeats the signal with the given period.TPlays the first signal for some time (in seconds) and then switches to the next one. afterSnd dur sig1 sig21Converts stereosignal to mono with function mean.$Length in seconds of the sound file.;Produces repeating segments with the given time in seconds.=Reads stereo signal from the sound-file (wav or mp3 or aiff).nReads stereo signal from the sound-file (wav or mp3 or aiff) and loops it with the given period (in seconds).`Reads stereo signal from the sound-file (wav or mp3 or aiff) and loops it with the file length.Reads the wav file with the given speed (if speed is 1 it's a norma playback). We can use negative speed to read file in reverse.$Reads th wav file and loops over it.Reads a segment from wav file. Reads the wav file with the given speed (if speed is 1 it's a norma playback). We can use negative speed to read file in reverse. Scales the tempo with first argument.JReads th wav file and loops over it. Scales the tempo with first argument.!The mono variant of the function readSnd.!The mono variant of the function  loopSndBy.!The mono variant of the function loopSnd.!The mono variant of the function readWav.!The mono variant of the function loopWav.Reads a segment from wav file.Reads the mono wav file with the given speed (if speed is 1 it's a norma playback). We can use negative speed to read file in reverse. Scales the tempo with first argument.OReads th mono wav file and loops over it. Scales the tempo with first argument.wLoads the sample in the table. The sample should be short. The size of the table is limited. It's up to 6 minutes for rWrites a sound signal to the file with the given format. It supports only four formats: Wav, Aiff, Raw and Ircam.Writes wav files.Writes aiff files.!Writes mono signals to wav files."Writes mono signals to aiff files./.." None-7Mono version of the cool reverberation opcode reverbsc. 'reverbsc1 asig feedbackLevel cutOffFreqReverb with given time.Mono reverb (based on reverbsc) rever1 feedback asigMono reverb (based on reverbsc) "rever2 feedback asigLeft asigRightMono reverb for small room.Mono reverb for small hall.Mono reverb for large hall.The magic cave reverb (mono).Stereo reverb for small room.Stereo reverb for small hall.Stereo reverb for large hall.The magic cave reverb (stereo).NThe simplest delay with feedback. Arguments are: delay length and decay ratio. echo delayLength ratioDelay with feedback. %fdelay delayLength decayRatio balanceDelay with feedback. 2fdelay maxDelayLength delayLength feedback balance?Multitap delay. Arguments are: max delay length, list of pairs (delayLength, decayRatio)1, balance of mixed signal with processed signal. *fdelay maxDelayLength delays balance asig'Generic multitap delay. It's just like fvdelaysj but instead of constant feedbackLevel it expects a function for processing a delayed signal on the tap. *fdelay maxDelayLength delays balance asig Distortion. distort distLevel asigChorus. chorus depth rate balance asig$Flanger. Lfo depth ranges in 0 to 1.!flanger lfo feedback balance asigFirst order phaser.GSecond order phaser. Sweeping gaps in the timbre are placed harmonicaly\Second order phaser. Sweeping gaps in the timbre are placed by powers of the base frequency. Distortion  fxDistort level drive tone sigInStereo distortion.Stereo chorus. $stChorus2 mix rate depth width sigInPhaser +fxPhaser mix rate depth freq feedback sigInStereo phaser.Flanger -fxFlanger mix feedback rate depth delay sigInStereo flanger Analog delay. (analogDelay mix feedback time tone sigInStereo analog delay.@Filter effect (a pair of butterworth low and high pass filters). (fxFilter lowPassfFreq highPassFreq gain GStereo filter effect (a pair of butterworth low and high pass filters). Equalizer (equalizer gainsAndFrequencies gain sigInStereo equalizer.@Equalizer with frequencies: 100, 200, 400, 800, 1600, 3200, 64000Equalizer with frequencies: 100, 400, 1600, 6400Gain fxGain gain sigIn'Adds filtered white noize to the signal fxWhite lfoFreq depth sigIn.Adds filtered white noize to the stereo signal&Adds filtered pink noize to the signal fxWhite lfoFreq depth sigIn-Adds filtered pink noize to the stereo signalSimplified delay ,fxEcho maxDelayLength delTime feedback sigInSimplified stereo delay.1--1None24&The stereo signal processing function.Widget that represents a mixer.DWidget that represents a mixer with horizontal grouping of elements.ETransforms the mono signal to the stereo input for the mixer widget.Creates a widget that represents a stereo signal processing function. The parameters of the widget are updated with sliders. For example let's create a simple gain widget. It can be encoded like this: uiGain :: Bool -> Double -> Source FxFun uiGain isOn gain = fxBox "Gain" fx isOn [("gain", gain)] where fx :: Sig -> Sig2 -> Sig2 fx = mul+Let's look at the arguments of the function fxBox name fx isOn argsname -- is the name of the widgetfx1 -- is signal processing function (see the class FxUI). isOn& -- whether widget in the active stateargsD -- list of initial values for arguments and names of the arguments..It's cool to set the color of the widget with fxColorD function. we can make our widgets much more intersting to look at.Colors the source widgets.-Scales the gui for signal processing widgets.iGroups the signal processing widgets. The functions are composed the visuals are grouped horizontaly.gGroups the signal processing widgets. The functions are composed the visuals are grouped verticaly.3Applies a function to a signal processing function.(The distortion widget. The arguments are +uiDistort isOn levelOfDistortion drive tone$The chorus widget. The arguments are #uiChorus isOn mix rate depth width %The flanger widget. The arguments are ,uiFlanger isOn mix feedback rate depth delay$The phaser widget. The arguments are /uiPhaser isOn mix feedback rate depth frequency#The delay widget. The arguments are (uiDelay isOn mix feedback delayTime tone.The simplified delay widget. The arguments are +uiEcho isOn maxDelayTime delayTime feedback%The pair of low and high pass filters 5uiFilter isOn lowPassfrequency highPassFrequency gain%The reverb widget. The arguments are: uiReverb mix depth"The gain widget. The arguments are uiGain isOn amountOfGain2The filtered white noize widget. The arguments are .uiWhite isOn centerFreqOfFilter amountOfNoize 1The filtered pink noize widget. The arguments are -uiPink isOn centerFreqOfFilter amountOfNoize NThe constructor for signal processing functions with no arguments (controlls).The reverb for room.The reverb for hall.The reverb for magic cave.,The widget for selecting a midi instrument. 0the widget for mixing in a signal to the signal.YA mixer widget represented as an effect. The effect sums the signals with given wieghts. A widget with four standard waveforms: pure tone, triangle, square and sawtooth. The last parameter is a default waveform (it's set at init time). Slider for master volume Knob for master volume:   .   .   /   -NoneNOPQRSTUVWXYZ[\]^,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   None1      !"#$%&'()*+,-./0123456789:  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & '      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./012345 ( )6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   *34534634734834934:34;34;3<=3<>3<?3<@3<A3<B3<C3<D3<E3<F3<G3<G3<H3<I3<J3<K3<L3<M3<N3<O3<O3<P3<Q3<R3<S3<T3<U3<V3<W3<X3<Y3<Z3<[3<\3<]3<^3<_3<`3<a3<b3<c3<d3<e3<f3<g3<h3<i3<j3<k3<l3<m3<n3<o3<p3<q3<r3<s3<t3<u3<v3<w3<x3<y3<z3<{3<{3<|3<}3<~3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<3<           !"#"$"%"&"'"(")"*+,+-+.+/+0+1+2+$+3+4+5+6+7+8+9+9+:+;<=<><?<@<A<B<C<D<EFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVWXWYWZW[W\W]W^W_W`WaWbWcWdWeWfWgWhWiWjWkWlWmWnWoWpWqWrWsWtWuWvWwWxWyWzW{W|W}W~WWWWWWWW      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklkmknkokpkpqrstuvwxyz{|}~                                         '!"#$(%)&'()*+,-. / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b cde.fghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd~efghijklmnopqrstuvwxyz{|}~                          !"#$%&'()*+,-./0123456789:;<=>?=>@=>A=>B=>C=>D=>E=>F=>G=>H=>I=>J=>K=>L=>M=>N=>O=>P=>Q=>R=>S=>T=>U=>V=>WXYZ[[\]]^__`aabccdeefgghiijkjljmjnjojpjqjrjsjtjujvjwjxjyjzj{j|j}j~jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj j j j j jjj2jjjjjjjjjjjjjjj0jjj j!j"j#j$j1j%j&j'j(j)j*j+j,j-j.j/j0j1j2j3j4j5j6j7j8j9j:j;j<j=j>j?j@jAjBjCjDjEjFjGjHjIjJjKjLjMjNjOjPjQj*jRjSjTjUjVjWjXjYjZj[j\j]j^j_j`jajbcdcecfcgchcicjckclcmcncocpcqcrcsctcucvcwcxcyczc{c|c}c~ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgfhfifjfkflfmfnfofpfqfrfsftfufvfwfxfyfzf{f#f|f}f~fffffffffffffffffff!fffffff"fffffffffffffffffffffff                     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkjljmjnjojpjqjrjstutvtwtxtytzt{t|t}t~tttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt                                   !  "  #  $  %  &  '  (  )  *  +  ,  - . / . 0 . 1 . 2 . 3 . 4 . 5 . 6 . 7 . 8 . 9 . : . ; . < . = . > ? @ ? A ? B ? C ? D ? E ? F G H G I G J G K L M L N L O L P L Q L R S T S U S V S W S X S Y S Z [ \ [ ] [ ^ [ _ [ ` [ a [ b [ c d e f d e g hcsound-expression-4.3Csound.Control.InstrCsound.OptionsCsound.Control.MidiCsound.Control.Gui.WidgetCsound.Control.GuiCsound.Air.WaveCsound.Control.SfCsound.Control.ChannelCsound.Control.Osc Csound.TypesCsound.Control.EvtCsound.Control.SE Csound.TabCsound.Control.Gui.PropsCsound.Control.Gui.LayoutCsound.Air.SpecCsound.Air.FilterCsound.SigSpace Csound.IOCsound.Air.EnvelopeCsound.Air.MiscCsound.Air.Wav Csound.Air.FxCsound.Air.Live!Csound.Control.Overload.SpecInstr!Csound.Control.Overload.MidiInstr Csound.BasemidimidinCsound.Control.Overload.OutsCsound.Control.OverloadCsound.Opcode.BasicmetrochangedtriggeraccumECsound.ControlCsound.Render.Mix renderCsdplayCsddacbuzz tabResolution CsdOptions Csound.AiroscBy Csound.Opcodelinsegexpseglinencsound-expression-dynamic-0.1.0Csound.Dynamic.Types.EventListCsdEventsingleCsdEventtoCsdEventListCsdScocsdEventListNotescsdEventListDur CsdEventListCsound.Dynamic.Types.Flags flagsVerbatimconfigdisplaysrtmidimidiRTmidiIO pulseAudiortaudioidTagsaudioFileOutputFlagsdithernopeaksnosoundinputoutput formatType formatSamplesAudioFileOutputNoHeader RewriteHeader FormatHeaderBit24AlawUcharSchar FloatSamplesUlawShortLong FormatSamples TriangularUniformDitherAiffAuAvrCafFlacHtkIrcamMat4Mat5NisPafPvfRawSd2SdsSvxVocW64WavWavexXi FormatTypeidTitle idSoftwareidDate idCopyright idCommentidArtistIdTags PortAudioAlsa jackOutport jackInport jackClientJackMme CoreAudio NoRtaudioRtaudiopaInputpaOutputpaServer PulseAudioterminateOnMidirawControllerMode muteTracks midiOutFilemidiFileMidiIO midiOutDevicemidiVelocityAmp midiVelocity midiKeyPch midiKeyOct midiKeyCpsmidiKey midiDeviceMidiRTPortMidiAlsaMidiMmeMidi WinmmMidi VirtualMidiNoRtmidiRtmidi listOpcodesdisplayVerbosemsgColor mBenchmarksmColoursmDb mWarningsmRangemAmps messageLeveldisplayHeartbeat displayMode csdLineNumsDisplays NoDisplayPostScriptDisplay AsciiDisplay DisplayModesetTempo skipSecondsstrsetNschedNumsetSchedsmacroomacroscoreInnewSrnewKrioBufhwBufConfigcsound-expression-opcodes-0.0.1 Csound.Typed.Opcode.RealtimeMIDIcpsmidiampmidictrl7csound-expression-typed-0.0.6.1Csound.Typed.Gui.WidgetkeyIn setToggle setToggleSigmeter setNumeric butBankSig1butBank1 butBankSigbutBank toggleSigtogglebuttonboxnumeric sliderBanksliderrollerknobjoycountcountSigsetTitledisplay sinkSourcesinksourcewidgetmscamvermhor mapGuiSource mapSource keyPanelBypanelBykeyPanelpanel keyPanelspanelsInputOutputInnerWidgetSinkSource SinkSourceDisplayCsound.Typed.ControlsetDurCsound.Typed.Control.Evtscheds_trigs_ schedHarpsBy schedHarpsschedsByschedstrigsBytrigsCsound.Typed.Control.Midipgmidi_midin_midi_pgmidiCsound.Typed.Control.Mixmix_mixBymixeffsco_scoMixCsound.Typed.Control.VcobloscsqrpulsetriisawsawCsound.Typed.Control.Sf2SfCsound.Typed.Control.Channel chnSetStr chnSetCtrl chnSetSigchnSetD chnGetStr chnGetSig chnGetCtrlchnGetDCsound.Typed.Control.OscsendOsc listenOscinitOscCsound.Typed.TypeswithSeedwithTabwithTabswithSigwithSigswithDwithDs withInitsCsound.Typed.Types.Evtsyncstepper evtToBoolsnapssnapshot filterAccumE filterAccumSEaccumSEfilterSEfilterEsigToEvt boolToEvtrunEvtEvtBamSnapCsound.Typed.Control.SERefglobalSensorsSEnewGlobalSERef sensorsSE modifySERefmixSERefnewSERef readSERef writeSERefSERefCsound.Typed.Types.TuplecaseArg guardedArgifArg caseTuple guardedTupleifTuplear8ar6ar4ar2ar1makeTupleMethods tupleMethodsTupleSigsArgCsound.Typed.Types.PrimftcpsftsrftchnlsftlennsampboolSigwhileDountilDowhenswhen1mod'div'rem'quot'round'int'frac'floor'ceil'sigirkrar getBlockSizegetControlRate getSampleRateidurtextintdouble forceNormskipNormunitSigDStrSpecWspecBoolSigBoolDUnitTabfromEtoGEfromGEValSigOrDCsound.Typed.GlobalState.SESECsound.Typed.GlobalState.GEMsgPressReleaseKeyEvtCharKeyF1F2F3F4F5F6F7F8F9F10F11F12ScrollCapsLook LeftShift RightShiftLeftCtrl RightCtrlEnterLeftAltRightAlt LeftWinKey RightWinKey BackspaceArrowUp ArrowLeft ArrowRight ArrowDownInsertHomePgUpDeleteEndPgDownNumLockNumDivNumMulNumSubNumHome NumArrowUpNumPgUp NumArrowLeftNumSpace NumArrowRightNumEnd NumArrowDown NumPgDownNumInsNumDelNumEnterNumPlusNum7Num8Num9Num4Num5Num6Num1Num2Num3Num0NumDotKey Csound.Typed.GlobalState.OptionsidMp3sidWins idBesselsidChebs2idChebs1idPolys idSplines idStartEndsidExpsidCubesidLinsidConstsidBuzzesidSines4 idPartialsidSines2idSines3idSines idDoublesidWavscoarseFifineFicsdTabFicsdGain csdBlockSize csdSampleRatecsdFlagsOptionsTabFiCsound.Typed.Gui.Gui setKnobType setOrient setButtonType setTextType setSliderType setEmphasis setFontType setFontSize setTextColor setColors setColor2 setColor1 setBoxType setMaterialsetLabel setBorder forcePropspropsmarginpaddingverScahorScascaspaceverhoruspanExpbspanuspanexpSpanlinSpanColorHorVerOrient valSpanScale valSpanDiapValSpan valDiapMax valDiapMinValDiapLinear Exponential ValScaleTypeValStep HelveticaCourierTimesSymbolScreenDingbatsFontType NoEmphasisItalicBold BoldItalicEmphasisThreeDPieClockFlatKnobTypeFillEngravedNice SliderType NormalTextNoDragNoEditTextType NoPlasticPlasticMaterialFlatBoxUpBoxDownBox ThinUpBox ThinDownBox EngravedBox EmbossedBox BorderBox ShadowBox RoundedboxRoundedShadowBoxRoundedFlatBox RoundedUpBoxRoundedDownBox DiamondUpBoxDiamondDownBoxOvalBox OvalShadowBox OvalFlatBoxBoxTypeNoBorder DownBoxBorder UpBoxBorderEngravedBorderEmbossedBorder BlackLineThinDownThinUp BorderType NormalButton LightButton CheckButton RoundButton ButtonTypeSetLabel SetMaterial SetBoxType SetColor1 SetColor2 SetTextColor SetFontSize SetFontType SetEmphasis SetSliderType SetTextType SetButtonType SetOrient SetKnobType SetLabelTypePropGuiCsound.Typed.GlobalState.CacheChannelCsound.Typed.Gui.BoxModelheightwidthpypxRectCpsInstr CpsInstrOutonCpsAmpInstr AmpInstrOutonAmp MidiInstr MidiInstrOutonMsgOutsSigOutstoOutsonArgampCpsmonoMsgholdMsgmonoMsgnholdMsgn pgmonoMsg pgholdMsginitc7 midiCtrl7midiCtrl umidiCtrltoSpecfromSpecmapSpec scaleSpecaddSpec scalePitchlphpbpbralpbhpblpbbpbbrmlpslideBindSigbindSigSigSpacemapSigmulatcfdcfd4cfdscfdSpeccfdSpec4cfdsSpecwsumsf2sfMsgsfMsg3sfMsgmsfMsg3m sfMsgLoopersfKeysfKey3sfKeymsfKey3m sfKeyLoopersfCpssfCps3sfCpsmsfCps3m sfCpsLoopersetRatessetBufssetGainsetJacksetDacsetAdcsetInput setOutputsetDacBysetAdcBysetThru setSilentSig8Sig6Sig4Sig2atArgatTupleRndsdevtmetroEloadbangimpulseimpulseE eventListchangedEtriggerEsyncBpm partitionE splitTogglecycleElistAtrangerandIntsrandDsrandListrandSkip randSkipByiterateErepeatEappendEmappendEoneOffreqOf freqAccumeverymaskedmixLoopmixLoop_ schedUntils schedToggle schedUntils_withDurswithDurtrigsched schedHarp schedUntiltrig_sched_ schedUntil_trigByschedBy schedHarpBy radioButton matrixButton funnyRadio funnyMatrixcharOncharOffuslideruknobxsliderxknobujoyhnumbersvnumbersknobPad togglePad buttonPadgenPadhradiovradio hradioSig vradioSigwinkeyWinlift1hlift2vlift2hlift2'vlift2'hlift3vlift3hlift3'vlift3'hlift4vlift4hlift4'vlift4'hlift5vlift5hlift5'vlift5' RenderCsd renderCsdBywriteCsd writeCsdBywriteSnd writeSndBy playCsdBydacByvdacvdacBycsdcsdBymplayer mplayerBytotemtotemBy PartialDC PartialPhasePartialStrength PartialNumberwavsmp3sdoublesexpseexpscubesecubeslinselinssplinesesplinesconstseconsts startEnds estartEndssinessines1sines2sines3sines4sinecosinesigmoidbuzzesbesselspolyschebs1chebs2 winHamming winHanning winBartlett winBlackman winHarris winRectanglewinSync winGaussian winKaisergen guardPointgpsetSize setDegreelllofillofilofimidfihifihhifihhhifiLfooscunipolarbipolaruoscuoscByusawuisawusqrutriupulseublosconuonrndhrndiurndhurndiwhitepinklfolegxegonIduronDurlindurexpdurlindurByexpdurBylinendur linendurByfadeInfadeOut expFadeIn expFadeOutfadesexpFadesstepSeqsahlinloopexploopconstSeqtriSeqsqrSeqsawSeqisqrSeqisawSeqxsawSeqixsawSeqxtriSeqlpsholdloopsegloopxseg lpsholdBy loopsegBy loopxsegByadsrSeqxadsrSeqadsrSeq_ xadsrSeq_holdSeqlinSeqexpSeqoddsevensonceonceByseveralmeanvibrate randomPitch chorusPitchresonsresonsBydryWetmodesfromMonorndPan2rndPangaussVolrndVol writeHifiselectorarpeggiarpBylpJoy SampleFormatFloat64Int24Uint8Float32Int32Int16 UlawSamples HeaderInt16 NoHeaderInt16NoHeaderFloat32LoopModeBounceLoopOncetakeSnddelaySnd segmentSnd repeatSndafterSndtoMono lengthSndsegmentsreadSnd loopSndByloopSndreadWavloopWav readSegWav tempoReadWav tempoLoopWavreadSnd1 loopSndBy1loopSnd1readWav1loopWav1 readSegWav1 tempoReadWav1 tempoLoopWav1ramSndramSnd1 writeSigswriteWav writeAiff writeWav1 writeAiff1 reverbsc1 reverTimerever1rever2 smallRoom smallHall largeHall magicCave smallRoom2 smallHall2 largeHall2 magicCave2echofdelayfvdelayfvdelays funDelays distortionchorusflangephase1 harmPhase powerPhase fxDistort fxDistort2 stChorus2fxPhaser fxPhaser2 fxFlanger fxFlanger2 analogDelay analogDelay2fxFilter fxFilter2 equalizer equalizer2eq7eq4fxGainfxWhitefxWhite2fxPinkfxPink2fxEchofxEcho2AdsrInitattInitdecInitsusInitrelInit AdsrBoundattBounddecBoundrelBoundFxUI applyFxArgsarityFxFxFunmixerhmixermixMonofxBoxfxColorfxScafxHorfxVerfxApp uiDistortuiChorus uiFlangeruiPhaseruiDelayuiEchouiFilteruiReverbuiGainuiWhiteuiPinkuiFxuiRoomuiHalluiCaveuiSiguiMixlinAdsrexpAdsr classicWaves masterVolumemasterVolumeKnob$fCpsInstr(->)$fCpsInstr(->)0$fCpsInstr(->)1$fCpsInstr(->)2$fCpsInstr(->)3$fCpsInstr(->)4$fCpsInstr(->)5$fCpsInstr(->)6$fCpsInstr(->)7$fCpsInstr(->)8$fCpsInstr(->)9$fCpsInstr(->)10$fCpsInstr(->)11$fCpsInstr(->)12$fCpsInstr(->)13$fCpsInstr(->)14$fCpsInstr(->)15$fCpsInstr(->)16$fCpsInstr(->)17$fCpsInstr(->)18$fCpsInstr(->)19$fCpsInstr(->)20$fCpsInstr(->)21$fCpsInstr(->)22 $fAmpInstr(,) $fAmpInstrSig $fAmpInstrSE $fAmpInstrSE0$fAmpInstr(->)$fAmpInstr(->)0$fAmpInstr(->)1$fAmpInstr(->)2$fAmpInstr(->)3$fAmpInstr(->)4$fAmpInstr(->)5$fAmpInstr(->)6sig2dsigsigdd2$fMidiInstr(->)$fMidiInstr(->)0$fMidiInstr(->)1$fMidiInstr(->)2$fMidiInstr(->)3$fMidiInstr(->)4$fMidiInstr(->)5$fMidiInstr(->)6$fMidiInstr(->)7$fMidiInstr(->)8$fMidiInstr(->)9$fMidiInstr(->)10$fMidiInstr(->)11$fMidiInstr(->)12$fMidiInstr(->)13$fMidiInstr(->)14$fMidiInstr(->)15$fMidiInstr(->)16$fMidiInstr(->)17$fMidiInstr(->)18$fMidiInstr(->)19$fMidiInstr(->)20$fMidiInstr(->)21$fMidiInstr(->)22$fMidiInstr(->)23$fMidiInstr(->)24$fMidiInstr(->)25$fMidiInstr(->)26$fMidiInstr(->)27$fMidiInstr(->)28$fMidiInstr(->)29$fMidiInstr(->)30$fMidiInstr(->)31$fMidiInstr(->)32$fMidiInstr(->)33$fMidiInstr(->)34$fMidiInstr(->)35$fMidiInstr(->)36$fMidiInstr(->)37$fMidiInstr(->)38$fMidiInstr(->)39$fMidiInstr(->)40$fMidiInstr(->)41$fMidiInstr(->)42$fMidiInstr(->)43$fMidiInstr(->)44$fMidiInstr(->)45$fMidiInstr(->)46$fMidiInstr(->)47$fMidiInstr(->)48$fMidiInstr(->)49$fMidiInstr(->)50$fMidiInstr(->)51$fMidiInstr(->)52$fMidiInstr(->)53$fMidiInstr(->)54$fOutsSE $fOutsSE0 $fOutsSE1 $fOuts(,,,) $fOuts(,) $fOutsSig genAmpCpsSiggenHoldAmpCpsSiggenCfds$fFractional(->)$fFractional(->)0$fFractional(->)1$fFractional(->)2$fFractional(->)3$fFractional(->)4$fFractional(->)5$fFractional(->)6$fFractionalSE$fFractionalSE0$fFractionalSE1$fFractionalSE2$fFractional(,,,)$fFractional(,,)$fFractional(,) $fNum(->) $fNum(->)0 $fNum(->)1 $fNum(->)2 $fNum(->)3 $fNum(->)4 $fNum(->)5 $fNum(->)6$fNumSE$fNumSE0$fNumSE1$fNumSE2 $fNum(,,,) $fNum(,,)$fNum(,) $fBindSigSE $fSigSpaceSE $fBindSigSE0 $fSigSpaceSE0 $fBindSigSE1 $fSigSpaceSE1 $fBindSigSE2 $fSigSpaceSE2$fBindSig(,,,)$fSigSpace(,,,) $fBindSig(,,)$fSigSpace(,,) $fBindSig(,) $fSigSpace(,) $fBindSigSig $fSigSpaceSigf2mSfFungenSfMsggenSfKeygenSfCpssfEnvbase Data.MonoidmemptymappendMonoid takeByWeightaccumWeightList patternToMask fromPlural fromPluralBy readMatrix genNumbers radioGroup radioGroupSiglift2lift2'lift3lift3'lift4lift4'lift5lift5'renderrender_simplePlayCsdBy setVirtualrunWithUserInterrupt $fRenderCsdSE$fRenderCsdSE0$fRenderCsdSE1$fRenderCsdSE2$fRenderCsdSE3$fRenderCsdSE4$fRenderCsd(->)$fRenderCsd(->)0$fRenderCsdSE5$fRenderCsdSE6$fRenderCsdSE7$fRenderCsdSE8$fRenderCsdSE9$fRenderCsdSE10$fRenderCsdSE11$fRenderCsd(,,,)$fRenderCsd(,)$fRenderCsd(,,,,,,,)$fRenderCsd(,,,,,)$fRenderCsd(,,,)0$fRenderCsd(,)0$fRenderCsdSig$fRenderCsdSE12WinTypeSync RectangleKaiserGaussianHarrisBlackmanBartlettHanningHamminginterpplains insertOnes findTableSize isPowerOfTwo winTypeIdwinsgenLoopsawListisawListtriListgenSeqintersperseEndsmoothadsrList adsrList_ genSegSeq relResonsByisMp3expScalelogScale dryWetMixfxWetuiMidigenMixer defSlider uiGroupGui sourceColor2fxGroupexpEpsgenAdsr $fFxUI(->) $fFxUI(->)0 $fFxUI(->)1$fSigSpace(->) Boolean-0.2.3 Data.Booleansort2BmaxBminBcaseBguardedBcropcondboolean||*&&*notBfalsetrueBoolean BooleanOfifBIfB/=*==*EqB<=*>*>=*<*OrdB<>mconcatgetDualDualappEndoEndogetAllAllgetAnyAnygetSumSum getProductProductgetFirstFirstgetLastLast$Csound.Typed.Opcode.SignalGeneratorswgpluck2wgpluckwgflutewgclarwgbrass wgbowedbarwgbowstresonrepluckpluckwterraintableitable3tabletabwtabw_itabtab_iptableiptable3ptableoscil1ioscil1 stkWurley stkWhistle stkVoicForm stkTubeBell stkStifKarpstkSitar stkSimple stkShakers stkSaxofony stkRhodey stkResonate stkPlucked stkPercFlutstkMoog stkModalBar stkMandolin stkHevyMetlstkFlute stkFMVoices stkDrummer stkClarinetstkBrassstkBowed stkBlowHole stkBlowBotl stkBeeThree stkBandedWGxscanu xscansmapxscansxscanmapscanu scantablescans scanhammerwavesetsndloopsfpresetsfplistsfplaymsfplay3msfplay3sfplay sfpassignsfloopersfloadsfinstrm sfinstr3msfinstr3sfinstrsfilist lposcilsa2 lposcilsalposcilalposcil3lposcillphasorloscilxloscil3loscilfluidSetInterpMethodfluidProgramSelectfluidOut fluidNote fluidLoad fluidEngine fluidControlfluidCCkfluidCCi fluidAllOutflooper2flooperbbcutsbbcutmweibullurdurandomunirandtrirandtrandomseedrnd31randomirandomhrandomrandirandhrandpoissonpinkishpcauchynoiselinrandjitter2jitter gausstriggaussigauss fractalnoiseexprandiexpranddust2dustduserrndcuserrndcauchyicauchybexprndbetarand syncphasor phasorbnkphasorvoicevibes tambourinestix sleighbellsshakersekere sandpaperprepianoplanetmoogmarimbamandolmandellorenzguirogogobelgendyxgendycgendy dripwatercrunchchuapcabasabarmodelbambooxadsrmxadsrmadsrlinenrenvlpxrenvlpxadsrtransegrtransegbtransegscalersplinelpsholdplooptsegloopsegplogcurvelinsegrlinsegblinejspline gainsliderexpsegrexpsegbaexpsegbexpsegaexponexpcurvecossegrcossegbcosseghvs3hvs2hvs1vosimsyncloop syncgrain sndwarpstsndwarp partikkelsync partikkelgranulegrain3grain2grainfogfof2fof diskgrainfoscilifoscilfmwurliefmvoicefmrhodefmpercflfmmetalfmbellfmb3 crossfmpmi crossfmpmcrosspmicrosspmcrossfmicrossfmvco2initvco2iftvco2ftvco2vcompulsegbuzzvibratovibrposcil3posciloscilsosciln oscilikts osciliktposciliktoscilioscil3osciloscbnkhsbosciladsynt2adsyntadsynCsound.Typed.Opcode.SignalIOmp3len filevalidfilesrfilepeak filenchnlsfilelenfilebitprintsprintksprintk2printkprintfprintf_iprint'flashtxtdispfftxoutxinsetksmpschnsetchnsendchnrecv chnparamschnmixchnget chnexportchnclearchn_Schn_achn_kchanochani soundoutssoundoutoutzoutxoutvalueouts2outs1outsoutrgoutq4outq3outq2outq1outqoutoouthoutchoutcout32outmonitormdelaysoundinmp3ininzinxinvalueinsinrginqinoinhinchin32in'diskin2diskinreadk4readk3readk2readkfprintsfprintksfoutkfoutirfoutifoutfiopenfinkfinifinficlosedumpk4dumpk3dumpk2dumpk#Csound.Typed.Opcode.SignalModifiersminaccum minabsaccumminabsmin'maxaccum maxabsaccummaxabsmax_kmax' powershapepdhalfypdhalfpdclip chebyshevpolywguide2wguide1zfilter2rbjeqpareqnlfilt2nlfilthilbertfofilterfilter2eqfildcblock2dcblocktonektlinetoresonxkresonkportkportlinetoatonekaresonkvlowrestbvcfsvfilterstatevarrezzyresonzresonyresonxresonrresonmoogvcf2moogvcf moogladderlpf18lowresxlowreslowpass2bqrezaresontonextonemodedopplerclfiltbutterlpbutterhpbutterbrbutterbpbutlpbuthpbutbrbutbpbiquadabiquadatonexatonephaser2phaser1harmon4harmon3harmon2harmonflangerdistort1distortwrapmirrorlimitvasetvagetupsampsampholdntrpolintegfolddownsampdiffdenormvcombvalpassreverbscreverb2reverbplaterevnreverbnestedapfreeverbcombinvcombbaboalpass vbapzmovevbapzvbapmove vbaplsinitvbapg vbap8movevbap8 vbap4movevbap4 vbap16movevbap16vbapspsendspdistspat3dtspat3dispat3dpan2panlocsiglocsendhrtfstat hrtfreverb hrtfmove2hrtfmove hrtfearly bformenc1bformenc bformdec1bformdec vdelayxws vdelayxwqvdelayxwvdelayxsvdelayxqvdelayxvdelay3vdelaymultitapdeltapxwdeltapxdeltapndeltapideltap3deltapdelaywdelayrvdel_kdelaykdelay1delay pconvolveftmorfftconvdconvcross2convolvegaindamcompressclipbalance%Csound.Typed.Opcode.InstrumentControltimestimek timeinsts timeinstkrtclock readclockdatesdate subinstrinitsubinstrstackpush_fpushpop_fpopxyinwiisendwiirangewiidata wiiconnecttrigseqtimedseqtempovaltempotempestsplitrigsetctrlseqtime2seqtimesensekeyrms rewindscoreptrackplltrack pitchamdfpitchpindexpeakpcountp5gdata p5gconnect miditempojoystickgetcfgfollow2followcontrolcheckboxpreallocmaxalloc jacktransportexitnowcpuprcactive scoreline_i scoreline schedwhenscheduleschedkwhennamed schedkwhenremove readscoremuteevent_ieventturnonturnoff2turnoffiholdclockonclockoff Csound.Typed.Opcode.JackoOpcodesjackoTransportjackoOn jackoNoteOutjackoMidiOutConnect jackoMidiOutjackoMidiInConnect jackoInit jackoInfojackoFreewheeljackoAudioOutConnect jackoAudioOutjackoAudioInConnect jackoAudioInCsound.Typed.Opcode.SerialIO serialWrite_i serialWrite serialRead serialPrint serialFlush serialEnd serialBegin Csound.Typed.Opcode.TableControlsndloadftgentmpftgenftfreeCsound.Typed.Opcode.FLTKflShow flSetTextType flSetTextSizeflSetTextColor flSetText flSetSize flSetPosition flSetFont flSetColor2 flSetColorflSetBox flSetAlignflLabelflHideflColor2flColor vphasesegflXyin flVslidBnk2 flVslidBnkflVkeybdflValueflUpdate flSlidBnkSetk flSlidBnkSetflSlidBnkGetHandleflSlidBnk2Setk flSlidBnk2Set flSlidBnk2 flSlidBnk flSetVal_iflSetValflSetSnapGroup flSetsnap flSavesnapflRun flPrintk2flPrintkflMouse flLoadsnapflKeyInflHvsBoxSetValueflHvsBox flGetsnap flExecButton flCloseButtonflButton flButBankflBoxflTextflSliderflRollerflKnobflJoyflCount flTabsEndflTabs flScrollEndflScroll flPanelEndflPanel flPackEndflPack flGroupEndflGroup*Csound.Typed.Opcode.MathematicalOperationstaninv2sum'product'pow polynomialmacamacdivzrndbirnddbfsampdbampampdbfsampdbvincrclear#Csound.Typed.Opcode.PitchConverterscpsxpchcpstunicpstuncps2pchsemitonepchoct pchmidinnoctpch octmidinnoctcpsoctavecpspchcpsoct cpsmidinncentmrtmsgmclockmidiprogramchangemidipolyaftertouch midipitchbend midinoteonpch midinoteonoct midinoteonkey midinoteoncps midinoteoff mididefaultmidicontrolchangemidichnmidichannelaftertouch noteondur2 noteondurnoteonnoteoffmoscilmidion2midionxtratimreleasemidioutmidiinpchmidibpchmidioctmidiboctmidicpstmidcpsmidibampmididoutkpcoutkpboutkpatoutkc14outkcoutkatoutipcoutipboutipatoutic14outicoutiatnrpnvelocpolyaft pgmassignpchbendnotnummidictrlmidic7midic21midic14massigninitc21initc14ctrlinitctrl21ctrl14chanctrlaftouch*Csound.Typed.Opcode.SignalFlowGraphOpcodes outletkidoutletkoutletfoutletainletkidinletkinletfinleta ftgenonce&Csound.Typed.Opcode.SpectralProcessing lorisread lorisplay lorismorph atsSinnoi atsReadnzatsRead atsPartialtap atsInterpreadatsInfoatsCross atsBufreadatsAddnzatsAddtrsplittrshifttrscaletrmixtrlowest trhighesttrfiltertrcrosstradsynsinsynresynpvsynthpvswarppvsvoc pvstencilpvspitchpvsoutpvsoscpvsmorphpvsmoothpvsmixpvsmaskapvslockpvsinitpvsinfopvsinpvsifdpvshiftpvsgain pvsfwritepvsftwpvsftr pvsfreezepvsfread pvsfilterpvsdisp pvsdiskinpvsdemixpvscrosspvscentpvscale pvsbufread2 pvsbufread pvsbufferpvsblurpvsbinpvsbandrpvsbandppvsarppvsanalpvsadsynpartialsbinitspectrumspecsumspecscalspecptrkspechistspecfiltspecdispspecdiffspecaddmlpslotlpresonlpreadlpinterplpfresonvpvoc tablexsegtablesegpvreadpvocpvinterppvcross pvbufreadpvadd ktablesegCsound.Typed.Opcode.Strings strupperkstrupperstrtolkstrtolstrtodkstrtod strlowerkstrlowerstrcharkstrcharstrsubkstrsub strrindexk strrindexstrlenkstrlen strindexkstrindexstrcpykstrcpystrcmpkstrcmpstrcatkstrcatsprintfksprintfputsstrsetstrgetCsound.Typed.Opcode.Vectorialvcellacellvrandivrandhvportvecdelayvdelaykvwrapvmirrorvlimitvlinsegvexpsegvsubv_ivsubvvpowv_ivpowvvmultv_ivmultvvmapvexpv_ivexpvvdivv_ivdivvvcopy_ivcopyvaddv_ivaddvvpow_ivpowvmult_ivmultvexp_ivexpvadd_ivaddvtabwkvtabwivtabwavtablewkvtablewivtablewavtablekvtableivtableavtable1kvtabkvtabivtaba"Csound.Typed.Opcode.ZakPatchSystemzkwmzkwzkrzkmodzkclziwmziwzirzawmzawzargzarzamodzakinitzacl!Csound.Typed.Opcode.PluginHosting vstprogset vstparamget vstparamsetvstnote vstmidioutvstinitvstinfovstedit vstbankload vstaudiogvstaudiodssilistdssiinitdssictls dssiaudio dssiactivateCsound.Typed.Opcode.Networkstsend socksendssocksendstrecv sockrecvssockrecv remoteport!Csound.Typed.Opcode.RemoteOpcodesmidremot midglobalinsremot insglobal Csound.Typed.Opcode.MixerOpcodesmixerSetLevel_i mixerSetLevel mixerSend mixerReceive mixerGetLevel mixerClear*Csound.Typed.Opcode.ImageProcessingOpcodes imagesize imagesetpixel imagesave imageload imagegetpixel imagefree imagecreate!Csound.Typed.Opcode.Miscellaneous tableshufflei tableshufflesystemsystem_ipwd modmatrix fareylenifareylendata-default-class-0.0.1Data.Default.ClassDefaultdef