нУЁh$Цo·л !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡ °²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопя р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫ З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧ!Ъ!─!│!┌!┐!└!┘!├!┤!┬!┴!┼!▀!▄!█!▌"▐"░"▒"▓"⌠"■"∙"√"≈"≤"≥" "⌡"°"²"·"÷"═"║"╒"ё"є"╔"і"ї"╗"╘"╙"╚"╛"ґ"ў"╞"╟"╠"╡"Ё"Є"╣"І"Ї"╦"╧"╨"╩"╪"ҐЎ©юаб#ц#д#е#ф#г#х#и#й#к#л#м#н#о#п#я#р#с#т#у#ж#в#ь#ы#з#ш#э#щ#ч#ъ#Ю#А#Б#Ц#Д#Е#Ф#Г#Х#И#Й#К#Л#М#Н#О#П#Я#Р#С#Т#У#Ж#В#Ь#Ы#З#Ш#Э#Щ#Ч#Ъ#─#│#┌#┐#└#┘#├#┤#┬#┴#┼#▀#▄#█#▌#▐#░#▒#▓#⌠#■#∙#√#≈#≤#≥# #⌡#°#²#·#÷#═#║#╒#ё#є#╔#і#ї#╗#╘#╙#╚#╛#ґ#ў#╞#╟#╠#╡#Ё#Є#╣#І#Ї#╦#╧#╨#╩#╪#Ґ#Ў#©#ю#а#б#ц#д#е#ф#г$х$и$й$к$л$м$н$о$п$я$р$с$т$у$ж$в$ь$ы$з$ш$э$щ$ч$ъ$Ю$А$БЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмн%о%п%я%р%с%т%у%ж%в%ь%ы%з%ш%э%щ%ч%ъ%Ю%А%Б%Ц%Д%Е%Ф%Г%Х%И%Й%К%Л%М%Н%О%П%Я%Р%С%Т%У%Ж%В%Ь%Ы%З%Ш%Э%Щ%Ч%Ъ%─%│%┌%┐%└%┘%├%┤%┬%┴%┼%▀%▄%█%▌%▐%░%▒%▓%⌠%■%∙%√%≈%≤%≥% %⌡%°%²%·%÷%═%║%╒%ё%є%╔%і%ї%╗%╘%╙%╚%╛%ґ%ў%╞%╟%╠%╡%Ё%Є%╣%І%Ї%╦%╧%╨%╩%╪%Ґ%Ў%©%ю%а%б%ц%д%е%ф%г%х%и%й%к%л%м%н%о%п%я%р%с%т%у%ж%в%ь%ы%з%ш%э%щ%ч%ъ%Ю%А%Б%Ц%Д%Е%Ф%Г%Х%И%Й%К%Л%М%Н%О%П%Я%Р%С%Т%У%Ж%В%Ь%Ы%З%Ш%Э%Щ%Ч%Ъ%─%│%┌%┐%└%┘%├%┤%┬%┴%┼%▀%▄%█%▌%▐%░%▒%▓%⌠%■%∙%√%≈%≤%≥% %⌡%°%²%·%÷%═%║%╒%ё%є%╔%і&ї&╗&╘&╙&╚&╛&ґ&ў&╞&╟&╠&╡&Ё&Є&╣&І&Ї&╦&╧&╨&╩&╪&Ґ&Ў&©&ю&а&б&ц&д&е&ф&г&х&и&й&к&л&м&н&о&п&я&р&с&т&у&ж&в&ь&ы&з&ш&э&щ&ч&ъ&Ю&А&Б&Ц&Д&Е&Ф&Г&Х&И&Й&К&Л&М&Н&О&П&Я&Р&С&Т&У&Ж&В&Ь&Ы&З&Ш&Э&Щ&Ч&Ъ&─&│&┌&┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡Ё'Є'╣'І'Ї'╦'╧'╨'╩'╪'Ґ'Ў'©'ю'а'б'ц'д'е'ф'г'х'и(й(к(л(м(н(о(п(я(р(с(т(у(ж(в(ь(ы(з(ш(э(щ(ч(ъ(Ю(А(Б(Ц(Д(Е(Ф(Г(Х(И(Й(К(Л(М(Н(О(П(Я(Р(С(Т(У(Ж(В(Ь(Ы(З(Ш(Э(Щ(Ч(Ъ(─(│(┌(┐(└(┘(├(┤(┬(┴(┼(▀(▄(█(▌(▐(░)▒)▓)⌠)■)∙)√)≈)≤)≥) )⌡)°)²)·)÷)═)║)╒)ё)є)╔)і)ї)╗)╘)╙)╚)╛)ґ)ў)╞)╟)╠)╡)Ё)Є)╣)І)Ї)╦)╧)╨)╩)╪)Ґ)Ў)©)ю)а)б)ц)д)е)ф)г)х)и)й)к)л)м)н)о)п)я)р)с)т)у)ж)в)ь)ы)з)ш)э)щ)ч)ъ)Ю)А)Б)Ц)Д)Е)Ф)Г)Х)И)Й)К)Л)М)Н)О)П)Я)Р)С)Т)У)Ж)В)Ь)Ы)З)Ш)Э)Щ)Ч)Ъ)─)│)┌)┐)└)┘)├)┤)┬)┴)┼)▀)▄)█)▌)▐)░)▒)▓)⌠)■)∙)√)≈)≤)≥) )⌡)°)²)·)÷)═)║)╒)ё)є)╔)і)ї)╗)╘)╙)╚)╛)ґ)ў)╞)╟)╠)╡)Ё)Є)╣)І)Ї)╦)╧)╨)╩)╪)Ґ)Ў)©)ю)а)б)ц)д)е)ф)г)х)и)й)к)л)м)н)о)п)я)р)с)т)у)ж)в)ь)ы)з)ш)э)щ)ч)ъ)Ю)А)Б)Ц)Д)Е)Ф)Г)Х)И)Й)К)Л)М)Н)О)П)Я)Р)С)Т)У)Ж)В)Ь)Ы)З)Ш)Э)Щ)Ч)Ъ)─ )│ )┌ )┐ )└ )┘ )├ )┤ )┬ )┴ )┼ )▀ )▄ )█ )▌ )▐ )░ )▒ )▓ )⌠ )■ )∙ )√ )≈ )≤ )≥ ) )⌡ )° )² )· )÷ )═ )║ )╒ )ё )є )╔ )і )ї )╗ )╘ )╙ )╚ )╛ )ґ )ў )╞ )╟ )╠ )╡ )Ё )Є )╣ )І *Ї *╦ *╧ *╨ *╩ *╪ *Ґ *Ў *© *ю *а *б *ц *д *е *ф *г *х *и *й *к *1NoneRВВcsound-expressionEuclidean beats.иScales series of scores by apllying series of stretching transformations.*euc totalLength initDelay durations scoresЬcsound-expression&Sets tempo in beats per minute, if 1 Dur, is equal to 1 second before transformation.Ыcsound-expression6Means 'three notes'. Plays three notes as fast as two.│csound-expressionSynonym to Ж (3/2)┌csound-expressiondouble │, str with 1.75!ВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈!В│┌ЬЫЗШЭЩЧЪ─┐└┘├┤┬┴▀┼▄█▌▐░▒▓⌠■∙√≈NoneS≤тыКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨Ґ╪╩т╧╨Ґ╪╩ы╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКNoneUє╔ії╗╘╙ґў╞╟╠╡ЁЄ╣ІЇЇІ╣ЄЁ╡╠╟╞ўґ╔іє╙╘╗ї+NoneUlє╔ії╗╘╙ґў╞╟╠╡ЁЄ╣ІЇ NoneUґ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ≥ ≈ ≤ √ ∙ ■ ⌠ ▓ NoneVr≤csound-expressionтLayouts the widgets in grid. The first argument is the number of widgets in the row.grid rowLength widgetsЭ Ч Ъ ─│┌┐└┘з≤┘└┐┌│─≤Ъ Ч зЭ NoneV╩?Л П Я Р С Т У Ж Ь Ы З Ш Щ ▄▐▌█╒·║═÷²°їі╔єёЇІ╣тсряпонмлЙИХГФЕДЦБАЮъчщэшцбаю©Ў?Щ Ш ЙИХГФЕДЦБАЮъчщэштсряпонмл▄цбаю©Ў╒·║═÷²°їі╔єёЇІ╣▐▌█З Ы Ь Ж У Т С Р Я П Л NoneX╨ csound-expression.Listens for continuous signal from OSC-channel#listenOscSig host address initValue⌡csound-expression7Listens for pair of continuous signals from OSC-channel$listenOscSig2 host address initValue ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ≥ ⌡ ░ █ ▌ ▐ ▄ ▀ ┼ ≥▒ ┬ ⌡┴ ,None>?юивY°²·÷-None>?юивZp═csound-expression┼Constructs a simple instrument that takes in a tuple of two arguments. They are amplitude and the frequency (in Hz or cycles per second).ёcsound-expressionМConstructs a drum-like instrument. Drum like instrument has a single argument that signifies an amplitude.═║╒ёє╔NoneZ ЕФГХИЙКЛМНОПЯРСі і СРЯМНПЛКИОЙХГФЕNoned▒іcsound-expressionSets sample rate and block sizesetRates sampleRate blockSizeїcsound-expression#Sets hardware and software buffers.setBufs hardwareBuf ioBuf╗csound-expressionхSets the default gain for the output signal (should be in range 0 to 1).╘csound-expression3Runs as JACK unit with given name (first argument).╙csound-expression╗Defines a header for a Jacko opcodes. The Jacko opcodes allow for greater flexibility with definition of Jack-client. See the Csound docs for details and the datatype Jacko.цcsound doc: ╚csound-expression1Sets real-time driver to Core Audio (use on OSX).╛csound-expression-Sets real-time driver to Alsa (use on Linux).ґcsound-expression.Sets real-time driver to Mme (use on Windows).ўcsound-expressionSends output to speakers.╞csound-expression#Reads input from audio-card inputs.╟csound-expression+Set's the input name of the device or file.╠csound-expression,Set's the output name of the device or file.╡csound-expression!Provides name identifier for dac.Ёcsound-expression!Provides name identifier for adc.Єcsound-expressionSets both dac and adc.╣csound-expressionSets the output to nosound.Іcsound-expression:Sets midi device. It's an string identifier of the device.²Read MIDI events from device DEVICE. If using ALSA MIDI (-+rtmidi=alsa), devices are selected by name and not number. So, you need to use an option like -M hw:CARD,DEVICE where CARD and DEVICE are the card and device numbers (e.g. -M hw:1,0). In the case of PortMidi and MME, DEVICE should be a number, and if it is out of range, an error occurs and the valid device numbers are printed. When using PortMidi, you can use '-Ma' to enable all devices. This is also convenient when you don't have devices as it will not generate an error.Їcsound-expressionSets midi device to all.╦csound-expressionдSets message level. For input integer value consult the Csound docs7http://csound.com/docs/manual/CommandFlagsCategory.html╧csound-expression=UTSRQPONMLKJIHGFEDCBA@]\[ZYXWVgfedcba`_^lkjihsrqponm}|{zyxwvut├┘└┐┌│─~∙■⌠▓▒░▐▌█▄▀┼┴┬┤≥≤≈√їі╔єё╒║═÷·²°⌡ Ц ЙИХГФЕДЦБАЮії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪╞ЙИХГФЕДЦБАЮЦ ії╗╘╪╛╚ґ╠╟ў╞╡ЁЄ╣ІЇ╦╧╨╩╙'&%$#"! 0/.-,+*)(321<;:987654UTSRQPONMLKJIHGFEDCBA@?>=]\[ZYXWVgfedcba`_^lkjihsrqponm}|{zyxwvut├┘└┐┌│─~∙■⌠▓▒░▐▌█▄▀┼┴┬┤≥≤≈√їі╔єё╒║═÷·²°⌡ None >?юабивh≈Ґcsound-expressionSpectral crossfade.Ўcsound-expression!Spectral bilinear crossfade (see cfd4).©csound-expressionGeneric spectral crossfade.юcsound-expression Weighted sum.аcsound-expressionгIt applies an effect and balances the processed signal by original one.бcsound-expression²It applies an effect and balances the processed signal by original one. Also it applies an effect and mixes the processed balanced signal with original one.╗ефгхийклнмпорятсвжуыьҐЎ©юабнмполк╗хвжуыьабгфеҐЎ©юрятсйиNone▀яцcsound-expressionFilter without a resonance.f centerFreq q asigдcsound-expressionResonant filter.f centerFreq q asigеcsound-expressionLow-pass filter.lp cutoff resonance sigфcsound-expressionHigh-pass filter.hp cutoff resonance sigгcsound-expressionBand-pass filter.bp cutoff resonance sigхcsound-expressionBand-reject filter.br cutoff resonance sigиcsound-expressionAll-pass filter.alp cutoff resonance sigйcsound-expressionHigh-pass filter.bhp cutoff sigкcsound-expressionLow-pass filter.blp cutoff sigлcsound-expressionBand-pass filter.bbp cutoff bandwidth sigмcsound-expressionBand-regect filter.bbr cutoff bandwidth sigнcsound-expressionMoog's low-pass filter.%mlp centerFrequency qResonance signalоcsound-expression╔Makes slides between values in the signals. The first value defines a duration in seconds for a transition from one value to another in piecewise constant signals.пcsound-expressionЄProduces smooth transitions between values in the signals. The first value defines a duration in seconds for a transition from one value to another in piecewise constant signals.smooth transTime asigяcsound-expressionщMakes fake resonant filter from flat filter. The resulting filter just ignores the resonance.рcsound-expression>Applies a filter n-times. The n is given in the first rgument.сcsound-expressionвApplies a flat filter (without resonance) n-times. The n is given in the first rgument.тcsound-expression7Low pass filter 18 dB with built in distortion module.)lp18 distortion centerFreq resonance asigdistortion's range is 0 to 1resonance's range is 0 to 1уcsound-expressionУAnother implementation of moog low pass filter (it's moogladder in Csound). The arguments have are just like in the mlp filter.mlp2 centerFreq q asigжcsound-expressionMooglowpass filter with 18 dB.mlp3 centerFreq q asigвcsound-expression2First order low pass filter (tone in Csound, 6 dB)lp1 centerFreq asigьcsound-expression4First order high pass filter (atone in Csound, 6 dB)hp1 centerFreq asigыcsound-expressionмResonance band pass filter (yet another implementation, it's reson in Csound)bp2 centerFreq q asigзcsound-expressionпResonance band reject filter (yet another implementation, it's areson in Csound)br2 centerFreq q asigшcsound-expressionFormant filter.$formant bandPassFilter formants asigБIt expects a band pass filter, a list of formants and processed signal. The signal is processed with each filter the result is a sum of all proceessed signals. Formant filters are used to mimic the vocalization of the sound.эcsound-expressionFormant filter that sings an A.щcsound-expressionFormant filter that sings an O.чcsound-expressionFormant filter that sings an E.ъcsound-expressionFormant filter that sings an U.Юcsound-expressionFormant filter that sings an O.Аcsound-expressionAnalog-like low-pass filter$alpf1 centerFrequency resonance asigБcsound-expressionAnalog-like low-pass filter$alpf2 centerFrequency resonance asigЦcsound-expressionAnalog-like low-pass filter(alpf3 centerFrequency resonanceance asigДcsound-expressionAnalog-like low-pass filter$alpf4 centerFrequency resonance asigAnalog outputs*asig1 -- 6dB/oct low-pass response output.+asig2 -- 12dB/oct low-pass response output.,asig3 -- 18dB/oct low-pass response output..+asig4 -- 24dB/oct low-pass response output.Еcsound-expressionAnalog-like high-pass filterahp centerFrequency asigФcsound-expression1Chebyshev type I low pass filter (with 2 poles).lpCheb1 centerFreq asigГcsound-expressionоChebyshev type I low pass filter (with given number of poles, first argument).lpCheb1' npols centerFreq asigХcsound-expression2Chebyshev type II low pass filter (with 2 poles).lpCheb2 centerFreq asigИcsound-expressionпChebyshev type II low pass filter (with given number of poles, first argument).lpCheb2' npols centerFreq asigЙcsound-expressionаButterworth lowpass filter based on clfilt opcode (with 2 poles).clp centerFreq asigКcsound-expressionъButterworth lowpass filter based on clfilt opcode (with given number of poles, first argument).clp' npols centerFreq asigЛcsound-expression2Chebyshev type I high pass filter (with 2 poles).hpCheb1 centerFreq asigМcsound-expressionпChebyshev type I high pass filter (with given number of poles, first argument).hpCheb1' npols centerFreq asigНcsound-expression3Chebyshev type II high pass filter (with 2 poles).hpCheb2 centerFreq asigОcsound-expressionяChebyshev type II high pass filter (with given number of poles, first argument).hpCheb2' npols centerFreq asigПcsound-expressionцButterworth high pass filter based on clfilt opcode (with 2 poles).chp centerFreq asigЯcsound-expressionАButterworth high pass filter based on clfilt opcode (with given number of poles, first argument).chp' npols centerFreq asigЧcsound-expressionMoog ladder filterladder centerFreq q asigЪcsound-expression plastic soundplastic centerFreq q asig─csound-expressionwobble soundwobble centerFreq q asig│csound-expressiontrumpy soundtrumpy centerFreq q asig┌csound-expressionharsh soundharsh centerFreq q asig┐csound-expressionнFixed version of tbfcv filter the first argument is distortion (range [0, 1])└csound-expressionState variable low-pass filter┘csound-expressionState variable high-pass filter├csound-expressionState variable band-pass filter┤csound-expression!State variable band-reject filter┼csound-expression4Zero-delay feedback implementation of 1 pole filter.&ouputs low-pass and high-pass signals.!zdf1 centerFreq asig = (alp, ahp)▀csound-expression=Zero-delay feedback implementation of 1 pole low-pass filter.zlp1 centerFreq asig▄csound-expression>Zero-delay feedback implementation of 1 pole high-pass filter.zhp1 centerFreq asig█csound-expression 1 increase the steepness of the NLP curve."diode saturation centerFreq q asig≤csound-expression Faster diode, but lesser quality#fdiode saturation centerFreq q asig≥csound-expression$Linear diode, no saturation involvedlinDiode centerFreq q asig csound-expression5Korg35 resonant low-pass filter. Q is unipolar [0, 1]$korg_lp saturation centerFreq q asig⌡csound-expression6Korg35 resonant high-pass filter. Q is unipolar [0, 1]$korg_hp saturation centerFreq q asig°csound-expression6Korg35 resonant band-pass filter. Q is unipolar [0, 1]$korg_bp saturation centerFreq q asig²csound-expression&Linear Korg35 resonant low-pass filterlinKorg_lp centerFreq q asig·csound-expression'Linear Korg35 resonant high-pass filterlinKorg_hp centerFreq q asig═csound-expressionAlias for korg_lp║csound-expressionAlias for korg_hp╒csound-expressionAlias for korg_bpЮцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ЮвьефгхиызкйлмдцрсянужтЧшэщчъЮпоАБЦДЕ┼▀▄█▌▐░▒▓⌠■∙√ФГХИЙКРСТУЖВЛМНОПЯЬЗЭЫШЩЪ─│┌┐≈≤≥²·÷ ⌡°═║╒└┘├┤┬┴NoneЮКСЫ╙csound-expressionPadsynth parameters.see for details: 4http://csound.github.io/docs/manual/GENpadsynth.htmlаcsound-expression$The default table. It's rendered to (-1) in the Csound.бcsound-expression┌Calculates the number of samples needed to store the given amount of seconds. It multiplies the value by the current sample rate.цcsound-expression;Calculates the closest power of two value for a given size.дcsound-expressionяCalculates the closest power of two value in samples for a given size in seconds.еcsound-expressionLoads wav or aiff file to tablewavs fileName skipTime channelbeg═+═(end═-═beg)═*═(1═-═exp(═i*type))═/═(1═-═exp(type * dur))$beg, end - end points of the segmentdur - duration of the segmentыcsound-expression.Equally spaced interpolation for the function startEnds)estartEnds [val1, type1, val2, typ2, ...]is the same as0estartEnds [val1, 1, type1, val2, 1, type2, ...]зcsound-expression&Linear segments in breakpoint fashion:$bpLins [x1, y1, x2, y2, ..., xN, yN] csound docs: -http://www.csounds.com/manual/html/GEN27.htmlЙAll x1, x2, .. should belong to the interval [0, 1]. The actual values are rescaled to fit the table size.шcsound-expression+Exponential segments in breakpoint fashion:$bpExps [x1, y1, x2, y2, ..., xN, yN] csound docs: -http://www.csounds.com/manual/html/GEN25.htmlЙAll x1, x2, .. should belong to the interval [0, 1]. The actual values are rescaled to fit the table size.эcsound-expressionSeries of harmonic partials:sine = sines [1]#saw = sines $ fmap (1 / ) [1 .. 10])square = sines $ fmap (1 / ) [1, 3 .. 11]нtriangle = sines $ zipWith (\a b -> a / (b ** 2)) (cycle [1, -1]) [1, 3 .. 11]щcsound-expression Just like ч$ but partial strength is set to one.чcsound-expression Just like ъ but phases are set to zero.ъcsound-expression1Specifies series of possibly inharmonic partials.Юcsound-expressionеSpecifies series of possibly inharmonic partials with direct current.Аcsound-expression4Sines with bandwidth (simplified padsynth generator)bwSines harmonics bandwidthБcsound-expressionтSines with bandwidth (simplified padsynth generator). Only odd harmonics are presentbwOddSines harmonics bandwidthЦcsound-expressionTable for pure sine wave.Дcsound-expressionTable for pure cosine wave.Еcsound-expressionTable for sigmoid wave.Фcsound-expressionTable for sigmoid rise wave.Гcsound-expressionTable for sigmoid fall wave.Хcsound-expressionюCreates tanh sigmoid. The argument is the radius of teh sigmoid.Иcsound-expression'Generates values similar to the opcode ./.цbuzzes numberOfHarmonics [lowestHarmonic, coefficientOfAttenuation]With buzzes n [l, r] you get n harmonics from l& that are attenuated by the factor of r on each step.Йcsound-expressionрModified Bessel function of the second kind, order 0 (for amplitude modulated FM).bessels xint,the function is defined within the interval [0, xint].Кcsound-expressionPolynomials.polys xl xr [c0, c1, c2, ..]whereнxl, xr - left and right values of the interval over wich polynomial is defined3[c0, c1, c2, ...] -- coefficients of the polynomialc0 + c1 * x + c2 * x * x + ...Лcsound-expression(Chebyshev polynomials of the first kind.polys xl xr [h0, h1, h2, ..]whereнxl, xr - left and right values of the interval over wich polynomial is defined6[h0, h1, h2, ...] -- relative strength of the partialsМcsound-expression)Chebyshev polynomials of the second kind.polys xl xr [h0, h1, h2, ..]whereнxl, xr - left and right values of the interval over wich polynomial is defined6[h0, h1, h2, ...] -- relative strength of the partialsНcsound-expression)The Hamming window. The peak equals to 1.Оcsound-expression)The Hanning window. The peak equals to 1.Пcsound-expression*The Bartlett window. The peak equals to 1.Яcsound-expression*The Blackman window. The peak equals to 1.Рcsound-expression(The Harris window. The peak equals to 1.Сcsound-expression+The Rectangle window. The peak equals to 1.Тcsound-expression&The Sync window. The peak equals to 1.Уcsound-expressionИThis creates a function that contains a Gaussian window with a maximum value of 1. The extra argument specifies how broad the window is, as the standard deviation of the curve; in this example the s.d. is 2. The default value is 1. winGauss 2Жcsound-expressionНThis creates a function that contains a Kaiser window with a maximum value of 1. The extra argument specifies how "open" the window is, for example a value of 0 results in a rectangular window and a value of 10 in a Hamming like window.winKaiser opennessВcsound-expressionSpecs for padsynth algorithm:*defPadsynthSpec partialBandwidth harmonics3partialBandwidth -- bandwidth of the first partial.2harmonics -- the list of amplitudes for harmonics.Ьcsound-expression8Creates tables for the padsynth algorithm (described at 1http://www.paulnasca.com/algorithms-created-by-meц). The table size should be very big the default is 18 power of 2. csound docs: 4http://csound.github.io/docs/manual/GENpadsynth.htmlЫcsound-expressionдCreates a table of doubles (It's f-table in Csound). Arguments are: identificator of the GEN routineGEN routine arguments9All tables are created at 0 and memory is never released.Зcsound-expression┼Adds guard point to the table size (details of the interpolation schemes: you do need guard point if your intention is to read the table once but you don't need the guard point if you read table in many cycles, the guard point is the the first point of your table).Шcsound-expression Shortcut for З.Эcsound-expressionбSets an absolute size value. As you can do it in the Csound files.Щcsound-expressionнSets the relative size value. You can set the base value in the options (see 0 at 1Ы, with tabResolution you can easily change table sizes for all your tables). Here zero means the base value. 1 is the base value multiplied by 2, 2 is the base value multiplied by 4 and so on. Negative values mean division by the specified degree.Чcsound-expressionSets degrees from -3 to 3.Ъcsound-expressionSets degrees from -3 to 3.─csound-expressionSets degrees from -3 to 3.│csound-expressionSets degrees from -3 to 3.┌csound-expressionSets degrees from -3 to 3.┐csound-expressionSets degrees from -3 to 3.└csound-expressionSets degrees from -3 to 3.┘csound-expression&Writes tables in sequential locations.ыThis opcode writes to a table in sequential locations to and from an a-rate variable. Some thought is required before using it. It has at least two major, and quite different, applications which are discussed below.kstart tablewa kfn, asig, koff csound docs: /http://www.csounds.com/manual/html/tablewa.html├csound-expressionжTransforms phasor that is defined in seconds to relative phasor that ranges in 0 to 1.┤csound-expression┌Table length in seconds for files that are read with GEN01 (which a re read with functions like wavs, wavTab, wavLeft, wavRight).┬csound-expression;Generates harmonic partials by analyzing an existing table.,tabHarmonics src minh maxh [ref_sr] [interp]ъsrc -- source ftable. It should be primitive ie constructed not with "ftgen" family of opcodes.minh -- lowest harmonic number'maxh -- maxh -- highest harmonic number┼ref_sr (optional) -- maxh is scaled by (sr / ref_sr). The default value of ref_sr is sr. If ref_sr is zero or negative, it is now ignored.≥interp (optional) -- if non-zero, allows changing the amplitude of the lowest and highest harmonic partial depending on the fractional part of minh and maxh. For example, if maxh is 11.3 then the 12th harmonic partial is added with 0.3 amplitude. This parameter is zero by default.GEN30 for Csound: -http://www.csounds.com/manual/html/GEN30.html┴csound-expressionЮIt's just like sines3 but inplace of pure sinewave it uses supplied in the first argument shape.бmixOnTab srcTable [(partialNumber, partialStrength, partialPahse)]phahse is in range [0, 1]┼csound-expression It's like mixOnTabХ but it's more generic since we can mix not only one shape. But we can specify shape for each harmonic.▀csound-expressionNormalizing tableCsound GEN04: -http://www.csounds.com/manual/html/GEN04.html▄csound-expressionБCreates a new table wich contains all values from the source table rescaled to the given interval.'scaleTab (minValue, maxValue) sourceTab█csound-expressionхtabseg -- Writes composite waveforms made up of pre-existing waveforms.#tabseg [(tab, amplitude, duration)]Csound GEN18: -http://www.csounds.com/manual/html/GEN18.htmlМButnotice the difference with Csound we specify start and finish of writing but here we only specify the relative length of segments. Segments are arranged so that the start f next segment comes right after the end of the prev segment.▐csound-expressionUniform (positive numbers only)░csound-expressionLinear (positive numbers only)▒csound-expression*Triangular (positive and negative numbers)▓csound-expression#Exponential (positive numbers only)⌠csound-expression-Biexponential (positive and negative numbers)■csound-expression(Gaussian (positive and negative numbers)∙csound-expression&Cauchy (positive and negative numbers)√csound-expression'Positive Cauchy (positive numbers only)≈csound-expressionBeta (positive numbers only)betaDist alpha betaalphaс -- alpha value. If kalpha is smaller than one, smaller values favor values near 0.betaж -- beta value. If kbeta is smaller than one, smaller values favor values near krange.≤csound-expressionWeibull (positive numbers only)╨tau -- if greater than one, numbers near ksigma are favored. If smaller than one, small values are favored. If t equals 1, the distribution is exponential. Outputs only positive numbers.≥csound-expressionPoisson (positive numbers only)╔csound-expressionгGenerates a random distribution using a distribution histogram (GEN40). Csound docs: -http://www.csounds.com/manual/html/GEN40.htmlіcsound-expression>randDist ■@ Generates a random list of numerical pairs (GEN41).иrandDist [value1, prob1, value2, prob2, value3, prob3 ... valueN, probN]║The first number of each pair is a value, and the second is the probability of that value to be chosen by a random algorithm. Even if any number can be assigned to the probability element of each pair, it is suggested to give it a percent value, in order to make it clearer for the user.РThis subroutine is designed to be used together with duserrnd and urd opcodes (see duserrnd for more information).їcsound-expressionяrangeDist ■@ Generates a random distribution of discrete ranges of values (GEN42).щThe first number of each group is a the minimum value of the range, the second is the maximum value and the third is the probability of that an element belonging to that range of values can be chosen by a random algorithm. Probabilities for a range should be a fraction of 1, and the sum of the probabilities for all the ranges should total 1.0.эThis subroutine is designed to be used together with duserrnd and urd opcodes (see duserrnd for more information). Since both duserrnd and urd do not use any interpolation, it is suggested to give a size reasonably big.╗csound-expressionReads numbers from file (GEN23)csound doc: -http://www.csounds.com/manual/html/GEN23.html╘csound-expression"Reads trajectory from file (GEN28)csound doc: -http://www.csounds.com/manual/html/GEN28.html╙csound-expressionReads PVOCEX files (GEN43)csound doc: -http://www.csounds.com/manual/html/GEN43.html╚csound-expression⌠readMultichannel ■@ Creates an interleaved multichannel table from the specified source tables, in the format expected by the ftconv opcode (GEN52).Хf # time size 52 nchannels fsrc1 offset1 srcchnls1 [fsrc2 offset2 srcchnls2 ... fsrcN offsetN srcchnlsN]csound doc: -http://www.csounds.com/manual/html/GEN52.html╛csound-expressionиCsound's GEN33 ■@ Generate composite waveforms by mixing simple sinusoids.tabSines1 srcTab nh scl [fmode] Csound docs: -http://www.csounds.com/manual/html/GEN33.htmlґcsound-expressionиCsound's GEN34 ■@ Generate composite waveforms by mixing simple sinusoids.tabSines2 srcTab nh scl [fmode] Csound docs: ,http://www.csounds.com/manual/html/GEN3.htmlўcsound-expression:"wave" ■@ Generates a compactly supported wavelet function.waveletTab srcTab seq Csound docs: /http://www.csounds.com/manual/html/GENwave.html╞csound-expressionь"wave" ■@ Generates a compactly supported wavelet function. The result table is rescaled.waveletTab srcTab seq Csound docs: /http://www.csounds.com/manual/html/GENwave.html╟csound-expression9Linear segments that form a singl cycle of triangle wave.╠csound-expression:Linear segments that form a single cycle of sawtooth wave.╡csound-expression8Linear segments that form a single cycle of square wave.Ёcsound-expressionАPulse-width wave formed with linear segments. Duty cycle rages from 0 to 1. 0.5 is a square wave.Єcsound-expression&Tab with tanh from the given interval.tanhTab (start, end)╣csound-expression=Tab with tanh from the given interval. The table is rescaled.rescaleTanhTab (start, end)Іcsound-expression-Tab with exponential from the given interval.expTab (start, end)Їcsound-expressionдTab with exponential from the given interval. The table is rescaled.rescaleExpTab (start, end)╦csound-expression&Tab with sone from the given interval.soneTab (start, end) equalpointЬstart, end -- first and last value to be stored. The points stored are uniformly spaced between these to the table size.пequalpoint -- the point on the curve when the input and output values are equal.╧csound-expression&Tab with sone from the given interval.soneTab (start, end) equalpointЬstart, end -- first and last value to be stored. The points stored are uniformly spaced between these to the table size.пequalpoint -- the point on the curve when the input and output values are equal.╨csound-expressionд"farey" ■@ Fills a table with the Farey Sequence Fn of the integer n.see details in Csound doc: 0http://www.csounds.com/manual/html/GENfarey.html?Notice that the arguments are reversed (in the haskell mindset)fareyTab mode num5num -- the integer n for generating Farey Sequence Fnйmode -- integer to trigger a specific output to be written into the table:д0 -- outputs floating point numbers representing the elements of Fn.И1 -- outputs delta values of successive elements of Fn, useful for generating note durations for example.Ж2 -- outputs only the denominators of the integer ratios, useful for indexing other tables or instruments for example./3 -- same as mode 2 but with normalised output.З4 -- same as mode 0 but with 1 added to each number, useful for generating tables for tuning opcodes, for example cps2pch.╩csound-expression9tablew ■@ Change the contents of existing function tables.╪This opcode operates on existing function tables, changing their contents. tablew is for writing at k- or at a-rates, with the table number being specified at init time. Using tablew with i-rate signal and index values is allowed, but the specified data will always be written to the function table at k-rate, not during the initialization pass. The valid combinations of variable types are shown by the first letter of the variable names.їtablew asig, andx, ifn [, ixmode] [, ixoff] [, iwgmode] tablew isig, indx, ifn [, ixmode] [, ixoff] [, iwgmode] tablew ksig, kndx, ifn [, ixmode] [, ixoff] [, iwgmode]csound doc: .http://www.csounds.com/manual/html/tablew.html╪csound-expression)Notice that this function is the same as tab?, but it wraps the output in the SE-monad. So you can use the tab, if your table is read-only and you can use readTabу if you want to update the table and the order of read/write operation is important.Fast table opcodes.цFast table opcodes. Faster than table and tablew because don't allow wrap-around and limit and don't check index validity. Have been implemented in order to provide fast access to arrays. Support non-power of two tables (can be generated by any GEN function by giving a negative length value).9kr tab kndx, ifn[, ixmode] ar tab xndx, ifn[, ixmode]csound doc: +http://www.csounds.com/manual/html/tab.htmlҐcsound-expression)Notice that this function is the same as table?, but it wraps the output in the SE-monad. So you can use the table, if your table is read-only and you can use readTableу if you want to update the table and the order of read/write operation is important.)Accesses table values by direct indexing.║ares table andx, ifn [, ixmode] [, ixoff] [, iwrap] ires table indx, ifn [, ixmode] [, ixoff] [, iwrap] kres table kndx, ifn [, ixmode] [, ixoff] [, iwrap]csound doc: -http://www.csounds.com/manual/html/table.htmlЎcsound-expression)Notice that this function is the same as tablei?, but it wraps the output in the SE-monad. So you can use the tablei, if your table is read-only and you can use readTableiу if you want to update the table and the order of read/write operation is important.бAccesses table values by direct indexing with cubic interpolation.єares table3 andx, ifn [, ixmode] [, ixoff] [, iwrap] ires table3 indx, ifn [, ixmode] [, ixoff] [, iwrap] kres table3 kndx, ifn [, ixmode] [, ixoff] [, iwrap]csound doc: .http://www.csounds.com/manual/html/table3.html©csound-expression)Notice that this function is the same as table3?, but it wraps the output in the SE-monad. So you can use the table3, if your table is read-only and you can use readTable3у if you want to update the table and the order of read/write operation is important.цAccesses table values by direct indexing with linear interpolation.єares tablei andx, ifn [, ixmode] [, ixoff] [, iwrap] ires tablei indx, ifn [, ixmode] [, ixoff] [, iwrap] kres tablei kndx, ifn [, ixmode] [, ixoff] [, iwrap]csound doc: .http://www.csounds.com/manual/html/tablei.htmlюcsound-expression6tableikt ■@ Provides k-rate control over table numbers.рk-rate control over table numbers. Function tables are read with linear interpolation. The standard Csound opcode tablei, when producing a k- or a-rate result, can only use an init-time variable to select the table number. tableikt accepts k-rate control as well as i-time. In all other respects they are similar to the original opcodes.Мares tableikt xndx, kfn [, ixmode] [, ixoff] [, iwrap] kres tableikt kndx, kfn [, ixmode] [, ixoff] [, iwrap]csound doc: 0http://www.csounds.com/manual/html/tableikt.htmlаcsound-expression5tablekt ■@ Provides k-rate control over table numbers.оk-rate control over table numbers. Function tables are read with linear interpolation. The standard Csound opcode table when producing a k- or a-rate result, can only use an init-time variable to select the table number. tablekt accepts k-rate control as well as i-time. In all other respects they are similar to the original opcodes.Кares tablekt xndx, kfn [, ixmode] [, ixoff] [, iwrap] kres tablekt kndx, kfn [, ixmode] [, ixoff] [, iwrap]csound doc: /http://www.csounds.com/manual/html/tablekt.htmlбcsound-expressionкtablexkt ■@ Reads function tables with linear, cubic, or sinc interpolation.еares tablexkt xndx, kfn, kwarp, iwsize [, ixmode] [, ixoff] [, iwrap]csound doc: 0http://www.csounds.com/manual/html/tablexkt.htmlцcsound-expressionаcuserrnd ■@ Continuous USER-defined-distribution RaNDom generator.6Continuous USER-defined-distribution RaNDom generator.Кaout cuserrnd kmin, kmax, ktableNum iout cuserrnd imin, imax, itableNum kout cuserrnd kmin, kmax, ktableNumcsound doc: 0http://www.csounds.com/manual/html/cuserrnd.html:the tab should be done with tabDist, randDist or rangeDistдcsound-expression?duserrnd ■@ Discrete USER-defined-distribution RaNDom generator.4Discrete USER-defined-distribution RaNDom generator.гaout duserrnd ktableNum iout duserrnd itableNum kout duserrnd ktableNumcsound doc: 0http://www.csounds.com/manual/html/duserrnd.html:the tab should be done with tabDist, randDist or rangeDistмФГзшэщч└ ┘ ├ ┤ ┬ ÷ ═ дефгхийклмнопярстужвьызшэщчъКёє╔ії╗╘╙╚╞╛ґў╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдм÷ ачщшэз┤КъчмГФбцдҐЎ©юЇ╦╧╨╩╪ефгхийкл╗╘╙╚╣ІЄЁэъчщЮИАБ┴┼╛ґў╞ЦДЕФГХ╟╠╡ЁЄ╣ІЇ╦╧╨жрпнть█зшвсяоуы▌КЛМЙ▐░▒▓⌠■∙√≈≤≥╔ ⌡°²·÷═║╒ёєіїНОПЯРУЖСТЬ╙╚╞╛ґў╟╠╡ії╗╘В┬▀ёє╔▄Ы┬ ┤ ЭЩЗШЧЪ─│┌┐└щйэшзыьвжутсрпяонмлкдихгфе├═ ├ ┘ └ ┘╩╪ҐЎ©юабцд Noneс6яcsound-expressionLow frequency oscillatorсcsound-expressionA pure tone (sine wave).тcsound-expressionюA pure tone (sine wave) with initial phase (the first argiment).уcsound-expression*An oscillator with user provided waveform.жcsound-expressionсAn oscillator with user provided waveform with initial phase (the second argiment).вcsound-expressionлTurns a bipolar sound (ranges from -1 to 1) to unipolar (ranges from 0 to 1)ьcsound-expressionмTurns an unipolar sound (ranges from 0 to 1) to bipolar (ranges from -1 to 1)ыcsound-expressionUnipolar pure tone.зcsound-expression Unipolar 23.шcsound-expressionUnipolar sawtooth.эcsound-expressionUnipolar integrated sawtooth.щcsound-expressionUnipolar square wave.чcsound-expressionUnipolar triangle wave.ъcsound-expressionUnipolar pulse.Юcsound-expression!Unipolar band-limited oscillator.Аcsound-expression⌡Unipolar random splines. It generates the splines with unipolar output (ranges from 0 to 1). Arguments affect the frequency for generation of new values.urspline cpsMin cpsMaxБcsound-expression Bipolar random splines. It generates the splines with bipolar output (ranges from -1 to 1). Arguments affect the frequency for generation of new values.birspline cpsMin cpsMaxЦcsound-expressionFrequency modulation+fosc carrierFreq modulatorFreq modIndex cpsДcsound-expression.Pulse width modulation (width range is 0 to 1)pw dutyCycle cpsЕcsound-expression.Pulse width modulation (width range is 0 to 1)pw' dutyCycle phase cpsФcsound-expression9Triangle wave with ramp factor (factor's range is 0 to 1)ramp factor cpsГcsound-expression9Triangle wave with ramp factor (factor's range is 0 to 1)ramp' factor phase cpsХcsound-expression%Unipolar pulse width modulation wave.Иcsound-expression'Unipolar triangle wave with ram factor.Тcsound-expression$Generic random smoothTypephase oscil┴csound-expressionгConstant random signal. It updates random numbers with given frequency. constRnd freq┼csound-expressionеLinear random signal. It updates random numbers with given frequency. rndi freq▀csound-expression Unipolar rndh▄csound-expression Unipolar rndi█csound-expressionWhite noise.▌csound-expressionPink noise.▐csound-expressionBrownian noise░csound-expressionLow frequency oscillatorlfo shape depth rate▒csound-expressionБScales the oscillator by frequency. That's how we can rise the pitch by 2 semitones and 15 cents:!detune (semitone 2 * cent 15) osc▓csound-expression▒Unision by Hertz. It creates n oscillators that are playing the same pitch slightly detuned. The oscillatos's pitch is evenly distributed in Hz.#multiHz numberOfUnits amountHz wave⌠csound-expression■Unision by Cents. It creates n oscillators that are playing the same pitch slightly detuned. The oscillatos's pitch is evenly distributed in cents.'multiCent numberOfUnits amountCent wave■csound-expression7Oscillators are detuned randomly in the given interval.&multiRnd numberOfUnits amountCent wave∙csound-expressionоOscillators are detuned randomly with Gauss distribution in the given interval.(multiGauss numberOfUnits amountCent wave√csound-expressionРOscillators are detuned randomly in the given interval. Useful for waves that return a signals with Side Effects.&multiRnd numberOfUnits amountCent wave≈csound-expression┼Oscillators are detuned randomly with Gauss distribution in the given interval. Useful for waves that return a signals with Side Effects.(multiGauss numberOfUnits amountCent wave≤csound-expression6Output is a set of harmonically related sine partials.buz numOfHarmonics frequency≥csound-expressionBuz with phase csound-expression8Output is a set of harmonically related cosine partials.'gbuz (minHarm, maxHarm) ratio frequency⌡csound-expressionGbuz with phaseЄcsound-expressionнLoops with cross-fades at the ends. We can specify loop segment (in seconds).╣csound-expression;Loops with cross-fades at the ends. Uses entire file lengthІcsound-expressionцReversed loop over table stereo files. Uses flooper under the hood.Їcsound-expression╨Loop over table stereo files. Uses loscil3 under the hood. Watch out for sample rates! If file sample rate is different from global project sample rate then playback will be distorted.╦csound-expressionсLoop over table stereo files with cubic interpolation. Uses loscil3 under the hood. Watch out for sample rates! If file sample rate is different from global project sample rate then playback will be distorted.╧csound-expression╦Loop over table mono files. Uses loscil3 under the hood. Watch out for sample rates! If file sample rate is different from global project sample rate then playback will be distorted.╨csound-expressionLoop from disk (stereo files)╩csound-expression&Reversed loop from disk (stereo files)╪csound-expressionLoop from disk (mono files)Ґcsound-expression$Reversed loop from disk (mono files)Ыь ы з ш э щ ч ъ Ю А Б Ц ярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЫрсуЦ Б Ю ъ ДА Фч тжщ э з ы Еш Гь УЖВЬЫЗШЭЩЧТ°²·÷═║╒ёє╔іївьызшэъщХчИЮЙКЛМНОПЯРСЪ─│┌┐└┘├┤┬╗╘╙╚╛ґў╞╟╠╡Ё┴▀┼▄█▌▐Ця░▒▓⌠■∙√≈АБ≤ ≥⌡Ї╦І╧╣Є╨╩╪ҐNone▀Ўcsound-expression1Hard sync with saw waveform and randomized phase.©csound-expression:Hard sync with integral saw waveform and randomized phase.юcsound-expression3Hard sync with pulse waveform and randomized phase.аcsound-expression4Hard sync with square waveform and randomized phase.бcsound-expression6Hard sync with triangle waveform and randomized phase.цcsound-expressionиHard sync with band-limited table waveform waveform and randomized phase.дcsound-expression-Hard-sync with non-bandlimited triangle wave.еcsound-expression+Hard-sync with non-bandlimited square wave.фcsound-expression-Hard-sync with non-bandlimited sawtooth wave.гcsound-expression0Hard-sync with non-bandlimited pulse-width wave.хcsound-expression-Hard-sync with non-bandlimited triangle wave.иcsound-expression+Hard-sync with non-bandlimited square wave.йcsound-expression-Hard-sync with non-bandlimited sawtooth wave.кcsound-expression0Hard-sync with non-bandlimited pulse-width wave.лcsound-expression-Hard-sync with non-bandlimited triangle wave.мcsound-expression+Hard-sync with non-bandlimited square wave.нcsound-expression-Hard-sync with non-bandlimited sawtooth wave.оcsound-expression0Hard-sync with non-bandlimited pulse-width wave.пcsound-expression-Hard-sync with non-bandlimited triangle wave.яcsound-expression+Hard-sync with non-bandlimited square wave.рcsound-expression-Hard-sync with non-bandlimited sawtooth wave.сcsound-expression0Hard-sync with non-bandlimited pulse-width wave.тcsound-expression·Soft sync with given waveform (with band-limited square wave for switch). The soft sync amount is controlled with ratio between master and slave frequencies.#softSync slaveWave ratio masterWaveуcsound-expressionрSoft sync with given waveform (with raw square wave for switch). It's faster than ту The soft sync amount is controlled with ratio between master and slave frequencies.&rawSoftSync slaveWave ratio masterWaveжcsound-expressionэSoft sync with given waveform (with band-limited square wave for switch). The soft sync amount is controlled with ratio between master and slave frequencies. With first argument we can specify the smoothness algorithm.*softSyncBy spec slaveWave ratio masterWaveвcsound-expressionрSoft sync with given waveform (with raw square wave for switch). It's faster than ж⌠ The soft sync amount is controlled with ratio between master and slave frequencies. With first argument we can specify the smoothness algorithm.-rawSoftSyncBy spec slaveWave ratio masterWaveьcsound-expression·Soft sync with given waveform (with band-limited square wave for switch). The soft sync amount is controlled with absolute frequency of the slave oscillator.&softSyncAbs slaveWave ratio masterWaveыcsound-expressionрSoft sync with given waveform (with raw square wave for switch). It's faster than ьу The soft sync amount is controlled with absolute frequency of the slave oscillator.)rawSoftSyncAbs slaveWave ratio masterWaveзcsound-expressionэSoft sync with given waveform (with band-limited square wave for switch). The soft sync amount is controlled with absolute frequency of the slave oscillator. With first argument we can specify the smoothness algorithm.-softSyncAbsBy spec slaveWave ratio masterWaveшcsound-expressionрSoft sync with given waveform (with raw square wave for switch). It's faster than з⌠ The soft sync amount is controlled with absolute frequency of the slave oscillator. With first argument we can specify the smoothness algorithm.-rawSoftSyncBy spec slaveWave ratio masterWaveт╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в И Х Г Ф Е Д Ў©юабцдефгхийклмнопярстужвьызштИ Х Г Ф Е Д в ж т с у р я п н м о л Ў©юабц© Ў ╪ ╩ Ґ ╨ ╧ ╦ І ╣ Ї Є к й х г и ф е д б а ц ю Ё ╡ ╟ ╞ ╠ ў ґ ╛ ╙ ╘ ╚ ╗ хийкдефгпярслмнотужвьызшNoneИ Хcsound-expression"Creates fm node with generic wave.fmOsc' wave modFreqИcsound-expressionCreates fm node with sine wave. fmOsc modFreqЙcsound-expressionяCreates fm node with signal generator (it's independent from the main frequency).Лcsound-expressionRenders Fm synth to function.Мcsound-expressionRenders mono output.Нcsound-expressionRenders stereo output.Пcsound-expression. +--+ 6 | +--+ 5 | 2 4 | | 1 3 +---+Яcsound-expressionи 6 | 5 +--+ | 2 | 4 +--+ | 1 3 +-----+Рcsound-expression0 +--+ 3 6 | | +--+ 2 5 | | 1 4 +---+Сcsound-expressionй +--+ 3 6 | | | | 2 5 | | | | 1 4 | | +--+ +---+эщчъЮАБЦДЕФГХИЙКЛМНОПЯРСГФХИЙКЛМНЮАБЦДЕэщчъОПЯРСNone ·Тcsound-expression'Settings for cross filtering algorithm.#They are the defaults for opvodes: pvsifd, tradsyn, trcross and partials.;Fft size degree -- it's the power of 2. The default is 12.8Hop size degree -- it's the power of 2. The default is 9.scale --amplitude scaling factor. default is 1/pitch -- the pitch scaling factor. default is 1 maxTracksй -- max number of tracks in resynthesis (tradsyn) and analysis (partials).winType$ -- O: Hamming, 1: Hanning (default)Search/ -- search interval length. The default is 1.05Depth -- depth of the effectThreshЯ -- analysis threshold. Tracks below ktresh*max_magnitude will be discarded (1 > ktresh >= 0).The default is 0.01 MinPointsы -- minimum number of time points for a detected peak to make a track (1 is the minimum).MaxGap┐ -- maximum gap between time-points for track continuation (> 0). Tracks that have no continuation after kmaxgap will be discarded.│csound-expressionConverts signal to spectrum.┌csound-expressionConverts spectrum to signal.┐csound-expression7Applies a transformation to the spectrum of the signal.└csound-expressionЭScales all frequencies. Usefull for transposition. For example, we can transpose a signal by the given amount of semitones:scaleSpec (semitone 1) asig┘csound-expression+Adds given amount of Hz to all frequencies.addSpec hz asig├csound-expressionScales frequency in semitones.┤csound-expressionлFilters the partials of the second signal with partials of the first signal.┬csound-expressionпSubstitutes the partials of the second signal with partials of the first signal.┴csound-expressioncrossSpecFilter for mono signals.┼csound-expressioncrossSpecVocoder for mono signals.ТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼│┌┐└┘├ТУЖВЬЫЗШЭЩЧЪ─┤┬┴┼None-' ▄csound-expression3D matrix (cube of vectors)█csound-expression2D matrix (grid of vecotrs)▌csound-expression 1D matrix▐csound-expression Hvs vector░csound-expressionДAllows one-dimensional Hyper Vectorial Synthesis (HVS) controlled by externally-updated k-variables.Иhvs1 allows one-dimensional Hyper Vectorial Synthesis (HVS) controlled by externally-updated k-variables.р hvs1 kx, inumParms, inumPointsX, iOutTab, iPositionsTab, iSnapTab [, iConfigTab]csound doc: ,http://www.csounds.com/manual/html/hvs1.html▒csound-expressionДAllows two-dimensional Hyper Vectorial Synthesis (HVS) controlled by externally-updated k-variables.Иhvs2 allows two-dimensional Hyper Vectorial Synthesis (HVS) controlled by externally-updated k-variables.Ц hvs2 kx, ky, inumParms, inumPointsX, inumPointsY, iOutTab, iPositionsTab, iSnapTab [, iConfigTab]csound doc: ,http://www.csounds.com/manual/html/hvs2.html▓csound-expressionФAllows three-dimensional Hyper Vectorial Synthesis (HVS) controlled by externally-updated k-variables.Кhvs3 allows three-dimensional Hyper Vectorial Synthesis (HVS) controlled by externally-updated k-variables.Т hvs3 kx, ky, kz, inumParms, inumPointsX, inumPointsY, inumPointsZ, iOutTab, iPositionsTab, iSnapTab [, iConfigTab]csound doc: ,http://www.csounds.com/manual/html/hvs3.html⌠csound-expressionоOne dimensional Hyper vectorial synthesis. We can provide a list of vectors (of lists but the same length for all items is assumed) and a signal that ranges from 0 to 1. It interpolates between vectors in the list. As a result we get a n interpolated vector. It's a list but the actual length equals to the length of input vectors.БAn example. We can set the center frequency and resonance of the filter with the single parameter:▄let f = hvs1 [[100, 0.1], [300, 0.1], [600, 0.5], [800, 0.9]] dac $ lift1 (\x -> fmap (\[cps, q] -> mlp cps q (saw 110)) $ f x) (uknob 0.5)тNotice the exact pattern match with the list in the argument of the lambda function:'\[cps, q] -> mlp cps q (saw 110)) $ f x=It's determined by the length of the items in the input list.■csound-expression─Two dimensional Hyper vectorial synthesis. Now we provide a list of lists of vectors. The length of all vectors should be the same but there is no limit for the number! So that's how we can control a lot of parameters with pair of signals. The input 2D atrix is the grid of samples. It finds the closest four points in the grid and interpolates between them (it's a weighted sum).hvs2 matrix (x, y)(The usage is the same as in the case of hvs1 . An example:жg = hvs2 [[[100, 0.1, 0.3], [800, 0.1, 0.5], [1400, 0.1, 0.8]], [[100, 0.5, 0.3], [800, 0.5, 0.5], [1400, 0.5, 0.8]], [[100, 0.8, 0.3], [800, 0.8, 0.5], [1400, 0.8, 0.8]]] main = dac $ do (g1, kx) <- uknob 0.5 (g2, ky) <- uknob 0.5 [cfq, q, w] <- g (kx, ky) panel $ hor [g1, g2] at (mlp cfq q) $ fmap (cfd w (saw 110)) (white)∙csound-expressionThe three dimensional ▄█▌▐░▒▓⌠■∙ ▐▌█▄⌠■∙░▒▓None?]≥фіcsound-expression└Aux parameters for ping pong delay. They are maximum delay time, low pass filter center frequency and Pan width. The defaults are (5 sec, 3500, 0.3).╚csound-expressionкDry/Wet mix value (ranges from 0 to 1). The 0 is all dry. The 1 is all wet.╛csound-expressionFeedback for delayґcsound-expressionThe delaya timeўcsound-expressionThe maximum delay time.╞csound-expression7Mono version of the cool reverberation opcode reverbsc.'reverbsc1 asig feedbackLevel cutOffFreq╟csound-expressionReverb with given time.╠csound-expressionMono reverb (based on reverbsc)rever1 feedback asig╡csound-expressionMono reverb (based on reverbsc)%rever2 feedback (asigLeft, asigRight)Ёcsound-expressionMono reverb for small room.Єcsound-expressionMono reverb for small hall.╣csound-expressionMono reverb for large hall.Іcsound-expressionThe magic cave reverb (mono).Їcsound-expressionStereo reverb for small room.╦csound-expressionStereo reverb for small hall.╧csound-expressionStereo reverb for large hall.╨csound-expressionThe magic cave reverb (stereo).╩csound-expressionAn alias for3let room dryWet asig = mixAt dryWet smallRoom2 asig╪csound-expressionAn alias for3let room dryWet asig = mixAt dryWet smallHall2 asigҐcsound-expressionAn alias for3let room dryWet asig = mixAt dryWet largeHall2 asigЎcsound-expressionAn alias for3let room dryWet asig = mixAt dryWet magicCave2 asig©csound-expressionвFast zero delay convolution with impulse response that is contained in mono-audio file.monoIR irFile ainюcsound-expression√Fast zero delay convolution with impulse response that is contained in mono-audio file. We can specify aux parameters for convolution algorithm (see zconv').monoIR' spec irFile ainаcsound-expressionыFast zero delay convolution with impulse response that is contained in stereo-audio file.stereoIR irFile ainбcsound-expression≤Fast zero delay convolution with impulse response that is contained in stereo-audio file. We can specify aux parameters for convolution algorithm (see zconv').stereoIR' spec irFile ainцcsound-expression+If IR is encoded in a couple of mono files.дcsound-expression+If IR is encoded in a couple of mono files.еcsound-expression7Precise mono IR with pconvolve (requires a lot of CPU).фcsound-expression9Precise stereo IR with pconvolve (requires a lot of CPU).хcsound-expressionнThe simplest delay with feedback. Arguments are: delay length and decay ratio.echo delayLength ratioиcsound-expressionDelay with feedback.2fdelay maxDelayLength delayLength feedback balanceйcsound-expression?Multitap delay. Arguments are: max delay length, list of pairs (delayLength, decayRatio)1, balance of mixed signal with processed signal.*fdelay maxDelayLength delays balance asigкcsound-expression'Generic multitap delay. It's just like fvdelaysИ but instead of constant feedbackLevel it expects a function for processing a delayed signal on the tap.*fdelay maxDelayLength delays balance asigлcsound-expressionсDelay for functions that use some table (as a buffer). As granular synth or mincer.8tabDelay fn maxDelayTime delayTime feedback balance asigмcsound-expressionPing-pong delay.$pingPong delayTime feedback mixLevelнcsound-expression-Ping-pong delay with miscellaneous arguments.*pingPong' spec delayTime feedback mixLevelоcsound-expressionвPing-pong delay defined in csound style. All arguments are present (nothing is hidden).еcsdPingPong maxTime delTime damp feedback width mixLevel (ainL, ainR)пcsound-expressionDistortion.distort distLevel asigяcsound-expressionChorus.chorus depth rate balance asigрcsound-expression$Flanger. Lfo depth ranges in 0 to 1.!flanger lfo feedback balance asigсcsound-expressionFirst order phaser.тcsound-expressionгSecond order phaser. Sweeping gaps in the timbre are placed harmonicalyуcsound-expressionэSecond order phaser. Sweeping gaps in the timbre are placed by powers of the base frequency.жcsound-expression Distortion fxDistort level drive tone sigInвcsound-expressionStereo chorus.$stChorus2 mix rate depth width sigInьcsound-expression Analog delay.(analogDelay mix feedback time tone sigInыcsound-expressionюFilter effect (a pair of butterworth low and high pass filters).'fxFilter lowPassfFreq highPassFreq gainзcsound-expression Equalizer(equalizer gainsAndFrequencies gain sigInшcsound-expressionюEqualizer with frequencies: 100, 200, 400, 800, 1600, 3200, 6400эcsound-expression0Equalizer with frequencies: 100, 400, 1600, 6400щcsound-expressionGainfxGain gain sigInчcsound-expression'Adds filtered white noize to the signalfxWhite lfoFreq depth sigInъcsound-expression&Adds filtered pink noize to the signalfxWhite lfoFreq depth sigInЮcsound-expressionSimplified delay,fxEcho maxDelayLength delTime feedback sigInАcsound-expressionЙInstrument plays an input signal in different modes. The segments of signal can be played back and forth.&trackerSplice maxLength segLength mode maxLength9 -- the maximum length of the played segment (in seconds) segLength! -- the segment length in secondsmode═ -- mode of the playing. If it's 1 - only a part of the sample is plyaed and it's played forward. The portion of the signal starts from the current playback point. It lasts for segLength. If it's 2 - the segment is played in reverse. Other values produce the normal input signal.Original author: Rory WalshExample:Лmain = dac $ do let ev ch1 ch2 dt = fmap (\x -> (x, dt)) $ mconcat [ fmap (const 1.5) $ charOn ch1 , fmap (const 2.5) $ charOn ch2 , fmap (const 0) $ charOff ch1 <> charOff ch2] (k, dt) <- stepper (0, 0.1) $ ev 'q' 'w' 0.1 <> ev 'a' 's' 0.2 <> ev 'z' 'x' 0.4 mul 1.3 $ trackerSplice 0.8 dt (int' k) $ fst $ loopWav 1 "drumLoop.wav"Бcsound-expressionPitchShifterDelay/A pitch shifter effect that employs delay linesрpitchShifterDelay maxDelayTime delayTime (feedback1, feedback2) transposeRatio ain Arguments maxDelayTime ; -- maximum delay time (kdlt should not exceed this value)transposeRatio ' -- pitch transposition (in semitones)delayTime Ф -- delay time employed by the pitch shifter effect (should be within the range ksmps/sr and imaxdlt)feedback1 Ъ -- feedback using method 1 (output from delay taps are fed back directly into their own buffers before enveloping and mixing)feedback2 Х -- feedback using method 2 (enveloped and mixed output from both taps is fed back into both buffers)--ain $ -- input audio to be pitch shiftedЦcsound-expressionДDelay line with low-pass filter in the feedback chain. The filter adds natural decay to the echoes.7fxAnalogDelay mixRatio delayTime feedback toneRatio ainэNote that the center frequency of the filter is measured in normalized units (form 0 to 1).Дcsound-expression%Distortion unit with low-pass filter.%fxDistortion driveLevel toneRatio ainэNote that the center frequency of the filter is measured in normalized units (form 0 to 1).Еcsound-expressionEnvelope follower.7fxFollower sensitivity baseFrequencyRatio resonance ain Arguments:sensitivity ц -- sensitivity of the envelope follower (suggested range: 0 to 1)baseFrequencyRatio ы -- base frequency of the filter before modulation by the input dynamics (range: 0 to 1); resonance > -- resonance of the lowpass filter (suggested range: 0 to 1)Фcsound-expression1An effect that reverses an audio stream in chunksfxReverse timetime& -- the size of the chunck in seconds.Гcsound-expressionхA flanger effect following the typical design of a so called 'stomp box'. fxFlanger rate depth delayTime feedback ain = Arguments rate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1) depth 2 -- depth of the lfo of the effect (range 0 to 1) delayTime > -- static delay offset of the flanging effect (range 0 to 1) feedback б -- feedback and therefore intensity of the effect (range 0 to 1) ain = -- input audio to which the flanging effect will be appliedХcsound-expressionPhaserйAn phase shifting effect that mimics the design of a so called 'stomp box'"fxPhaser rate depth freq fback ain Arguments:rate - -- rate of lfo of the effect (range 0 to 1)depth . -- depth of lfo of the effect (range 0 to 1)freq в -- centre frequency of the phase shifting effect in octaves (suggested range 6 to 11)fback б -- feedback and therefore intensity of the effect (range 0 to 1)ain $ -- input audio to be pitch shiftedИcsound-expressionLoFiн'Low Fidelity' distorting effects of bit reduction and downsampling (foldover)fxLoFi bits fold ain = ... Argumentsbits ' -- bit depth reduction (range 0 to 1)fold & -- amount of foldover (range 0 to 1)ain ю -- input audio to have low fidelity distortion effects appliedЙcsound-expression Stereo ChorusA stereo chorus effect.fxChorus2 rate depth width (ainLeft, ainRight) Argumentsrate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1)depth 2 -- depth of the lfo of the effect (range 0 to 1)width , -- width of stereo widening (range 0 to 1)ainX -- input stereo signalКcsound-expressionAuto panfxAutoPan wave rate depth ain; Arguments:wave : -- waveform used by the lfo (0=sine 1=triangle 2=square)rate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1)depth 2 -- depth of the lfo of the effect (range 0 to 1)mode 2 -- mode of the effect (0=auto-panning 1=tremolo)ain -- input stereo audioЛcsound-expressionTremolotremolo effectfxTrem wave rate depth ain; Arguments:wave : -- waveform used by the lfo (0=sine 1=triangle 2=square)rate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1)depth 2 -- depth of the lfo of the effect (range 0 to 1)mode 2 -- mode of the effect (0=auto-panning 1=tremolo)ain -- input stereo audioМcsound-expressionPitchShifter.A pitch shifter effect based on FFT technology?юивq ёcsound-expressionЮConverts a value to the midi-instrument with custom temperament. It's used with the functions 5, 6.╔csound-expressionфConverts a value to the midi-instrument. It's used with the functions 5, 6.ёє╔ії7NoneqH°²·÷═║╒ёє╔ёє╔іїNone?я┴ч.╗csound-expression0Represents a values with frequency of occurence.╙csound-expression╩Converts event stream to signal. The first argument is initial value. It holds the value while nothing happens. If the event happens it overwrites the current value of the output signal.╚csound-expressionАConverts an event stream to boolean signal. It's True when something happens and False otherwise.╛csound-expressionДCreates a trigger signal out of event stream. It equals to 1 when something happens and 0 otherwise.ґcsound-expressionуConstant event stream. It produces the same value (the first argument) all the time.ўcsound-expression Behaves like .8, but returns an event stream.╞csound-expressionюCreates a stream of events that happen with the given frequency.╟csound-expression!Csound's original metro function.╠csound-expressionжCreates a stream of ticks that happen around the given frequency with given deviation.gaussTrig freq deviation╡csound-expressionяCreates a stream of random events. The argument is a number of events per second.dust eventsPerSecondЁcsound-expressionнCreates a signal that contains a random ones that happen with given frequency.Єcsound-expressionъCreates a signal that contains a random ones or negative ones that happen with given frequency.╣csound-expressionFires a single event right now.loadbang = pulseE 0Іcsound-expression2Fires a single true value in the given time ahead.Їcsound-expression-Fires a single event in the given time ahead.╦csound-expression*Makes an event stream from list of events.╧csound-expression Behaves like .9, but returns an event stream.╨csound-expression Behaves like .:, but returns an event stream.╩csound-expression;the sync function but time is measured in beats per minute.╪csound-expression2Splits event stream on two streams with predicate.Ґcsound-expression9Splits a toggle event stream on on-events and off-events.Ўcsound-expressionВConstructs an event stream that contains pairs from the given pair of signals. Events happens when any signal changes.©csound-expressionКConstructs an event stream that contains an infinite repetition values from the given list. When an event happens this function takes the next value from the list, if there is no values left it starts from the beggining of the list.юcsound-expressionАTurns an event of indices to the event of the values from the list. A value is taken with index.аcsound-expression1range (xMin, xMax) === cycleE [xMin .. pred xMax]бcsound-expression>An event stream of the integers taken from the given diapason.цcsound-expression5An event stream of the random values in the interval (0, 1).дcsound-expression9An event stram of lists of random values in the interval (0, 1)5. The first argument is the length of the each list.еcsound-expressionSkips elements at random. randSkip probwhere prob? is probability of includinng the element in the output stream.фcsound-expressionSkips elements at random.randSkip probFunIt behaves just like randSkip', but probability depends on the value.гcsound-expressionҐWhen something happens on the given event stream resulting event stream contains an application of some unary function to the given initial value. So the event stream contains the values:'[s0, f s0, f (f s0), f (f (f s0)), ...]хcsound-expressionиSubstitutes all values in the input stream with the given constant value.иcsound-expressionУAccumulates a values from the given event stream with binary function. It's a variant of the fold for event streams.appendE z f evtWhen value a happens with evt2, the resulting event stream contains a value (z f a) and in the next time z equals to this value.йcsound-expression"A special variant of the function и$ for the monoids. Initial value is л and binary function is м , which belong to the instance of the class н .кcsound-expressionИConstructs an event stream that contains values from the given list which are taken in the random order.лcsound-expressionДConstructs an event stream that contains values from the given list which are taken in the random order. In the list we specify not only values but the frequencies of occurrence. Sum of the frequencies should be equal to one.мcsound-expression%This function combines the functions ; and л─. We transform the values of the event stream with stateful function that produce not just values but the list of values with frequencies of occurrence. We apply this function to the current state and the value and then at random pick one of the values.нcsound-expressionSpecialization of the function о.every n [a, b, c, ..] evt#constructs a mask that skips first nх elements and then produces an event and skips next (a - 1) events, then produces an event and skips next (b - 1) events and so on. It's useful for construction of the percussive beats. For exampleevery 0 [2] (metroE 2)Йtriggers an event on the odd beats. With this function we can create a complex patterns of cyclic events.оcsound-expressionКFilters events with the mask. A mask is a list of ones and zeroes. n'th element from the given list should be included in the resulting stream if the n'th element from the list equals to one or skipped if the element equals to zero.пcsound-expression?юивы▓ вcsound-expression,Mixes the scores and plays them in the loop.ьcsound-expression0Mixes the procedures and plays them in the loop.ыcsound-expressionЙInvokes an instrument with first event stream and holds the note until the second event stream is active.зcsound-expressionжInvokes an instrument with toggle event stream (1 stands for on and 0 stands for off).шcsound-expressionЙInvokes an instrument with first event stream and holds the note until the second event stream is active.эcsound-expression∙Transforms an instrument from always on to conditional one. The routput instrument plays only when condition is true otherwise it produces silence.щcsound-expression╔Plays infinite notes for a given instrument with event stream. It allows for note overlap on release. We can specify release time on seconds in the first argument.!schedStream releaseTime instr evtчcsound-expressionфSets the same duration for all events. It's useful with the functions sched, schedBy, sched_.Юcsound-expression>Executes some procedure for the whole lifespan of the program,Аcsound-expressionTurns off named instruments.%turnoffNamedInstr name kmode krelease/name of the instrument (should be defined with trigByName or smth like that).%kmode -- sum of the following values:к0, 1, or 2: turn off all instances (0), oldest only (1), or newest only (2)Я4: only turn off notes with exactly matching (fractional) instrument number, rather than ignoring fractional partю8: only turn off notes with indefinite duration (p3 < 0 or MIDI)▌krelease -- if non-zero, the turned off instances are allowed to release, otherwise are deactivated immediately (possibly resulting in clicks);Д Е Ф Г С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ⌡ ° ² · ÷ ═ ║ ╒ МНОТСПРЯУЖ°²·÷═║╒ёє╔вьызшэщчъЮА;╒ ║ ═ ° · ² в÷ ь⌡ МНОТСПРЯУЖЬ ъУ ызВ шЖ Т щчС Ф Г Д Е АЮэ°²·÷ёє╔═║╒│ ─ Ъ Ы Ч Щ Э Ш З None?ё4Цcsound-expression'Specifies the midi channel or programm.Йcsound-expressionщConverts midi velocity number to amplitude. The first argument is dynamic range in decibels.4ampmidinn (volMinDb, volMaxDb) volumeKey = amplitudeКcsound-expression0Midi message convertion with custom temperament.Лcsound-expression6Midi message convertion to Hz with custom temperament.Мcsound-expressionоMidi pitch key convertion to Hz with custom temperament. It works on constants.Нcsound-expressionмMidi pitch key convertion to Hz with custom temperament. It works on signals.Оcsound-expressionЪProduces midi amplitude and frequency as a signal. The signal fades out when nothing is pressed. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another.*monoMsg channel portamentoTime releaseTimeПcsound-expression║Produces midi amplitude and frequency as a signal. The signal fades out when nothing is pressed. It can be used in mono-synths. Arguments are custom temperament, midi channel, portamento time and release time. A portamento time is time it takes for transition from one note to another.:monoMsgTemp temperament channel portamentoTime releaseTimeЯcsound-expressionЧProduces an argument for monophonic midi-synth. The signal fades out when nothing is pressed. It can be used in mono-synths.genMonoMsg channelРcsound-expressionJust like mono genMonoMsgх but also we can alter the temperament. The temperament spec goes first."genMonoMsgTemp temperament channelУcsound-expressionJust like mono genMonoMsgх but also we can alter the temperament. The temperament spec goes first."genMonoMsgTemp temperament channelЖcsound-expression┤Produces midi amplitude and frequency as a signal and holds the last value till the next one is present. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another.holdMsg portamentoTimeВcsound-expression┤Produces midi amplitude and frequency as a signal and holds the last value till the next one is present. It can be used in mono-synths. Arguments are portamento time and release time. A portamento time is time it takes for transition from one note to another.holdMsg portamentoTimeЬcsound-expression√Creates a named instrument that can be triggered with Csound API. This way we can create a csd file that can be used inside another program/language.эIt simulates the input for monophonic midi-like instrument. Notes are encoded with messages:Дi "givenName" 1 pitchKey volumeKey -- note on i "givenName" 0 pitchKey volumeKey -- note off The output is a pair of signals (midiVolume, midiPitch).Зcsound-expressionЧListens to midi on event on the given key as event stream. The event stream carries the level of volume (ranges from 0 to 1).Шcsound-expression;Listens to midi on event off the given key as event stream.Эcsound-expression,Initialization of the midi control-messages.Щcsound-expressionоInitializes control rate midi control and get the value in the specified range.Чcsound-expressionоInitializes control rate midi control and get the value in the range (-1) to 1.Ъcsound-expressionъUnipolar control rate midiCtrl. Initializes midi control and get the value in the range 0 to 1.─csound-expressionмInitializes audio-rate midi control and get the value in the specified range.│csound-expressionмInitializes audio-rate midi control and get the value in the range (-1) to 1.┌csound-expressionщUnipolar audio-rate midiCtrl. Initializes midi control and get the value in the range 0 to 1.┐csound-expression4Invokes ooverloaded instruments with midi. Example:*dac $ tryMidi (mul (fades 0.01 0.1) . tri)└csound-expressionкInvokes ooverloaded instruments with midi and custom temperament. Example:6dac $ tryMidi' youngTemp2 (mul (fades 0.01 0.1) . tri)3бдъ┌ ┐ └ ┘ ├ ┤ ї Лёє╔іїБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└3ЦДЕФБГХї Л┤ ├ ┘ И└ ┐ ┌ ОЖЬЯСТУПВРЗШбдЭъЩЧЪ─│┌ЙКЛМН┐└╔іїёєЫNone╠с┤csound-expressionпCreates a midi instrument from sf2 sound font. Midi listens on all channels. It's useful to quickly test a sound font. The second argument is a sustain in seconds. How long it takes for the sound to decay.┬csound-expressionпCreates a midi instrument from sf2 sound font. Midi listens on all channels. It's useful to quickly test a sound font. The second argument is a sustain in seconds. How long it takes for the sound to decay.┴csound-expression┴Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with linear interpolation.┼csound-expression┬Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with cubic interpolation.▀csound-expression═Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with linear interpolation. Produces mono output.▄csound-expression÷Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with cubic interpolation. Produces mono output.█csound-expressionэMidi looper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.▌csound-expression┴Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with linear interpolation.▐csound-expression┬Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with cubic interpolation.░csound-expression═Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with linear interpolation. Produces mono output.▒csound-expression÷Creates a midi instrument from sf2 sound font file. The second argument is sustain in seconds. Reads samples with cubic interpolation. Produces mono output.▓csound-expressionэMidi looper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.⌠csound-expression└Reads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is linear.■csound-expression┐Reads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is cubic.∙csound-expression≥Reads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is linear. The output is mono.√csound-expression≤Reads sf2 samples at given midi velocity and key (both are from 0 to 127). The second argument is sustain. Interpolation is cubic. The output is mono.≈csound-expressionвLooper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.≤csound-expressionщReads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is linear.≥csound-expressionэReads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is cubic. csound-expressionРReads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is linear. The output is mono.⌡csound-expressionЯReads sf2 samples with amplitude in (0, 1) and frequency in Hz. The interpolation is cubic. The output is mono.°csound-expressionвLooper of the sf2 samples. The first arguments are: start, end, crossfade of the loop.ї і ┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°ї і ┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°NoneлК)²csound-expression#Pair of minimum and maximum values.·csound-expression6A radio button. It takes a list of values with labels.÷csound-expressionA matrix of values.═csound-expressionуRadio button that returns functions. Useful for picking a waveform or type of filter.║csound-expressionMatrix of functional values.╒csound-expressionShortcut for press И events.ёcsound-expressionShortcut for release И events.єcsound-expressionгCreates an event in the output stream when one of the chars is pressed.╔csound-expressionиCreates an event in the output stream when one of the chars is depressed.іcsound-expressionЕUnipolar linear slider. The value belongs to the interval [0, 1]. The argument is for initial value.їcsound-expressionЦUnipolar linear knob. The value belongs to the interval [0, 1]. The argument is for initial value.╗csound-expressionцExponential slider (usefull for exploring frequencies or decibels).xknob (min, max) initValжThe value belongs to the interval [min, max]. The last argument is for initial value.╘csound-expressionаExponential knob (usefull for exploring frequencies or decibels).xknob (min, max) initValжThe value belongs to the interval [min, max]. The last argument is for initial value.╙csound-expressionUnit linear joystick.╚csound-expressionюThe sample and hold widget. You can pick a value from the list of doubles. The original value is a head of the list (the first element). The visual grouping is horizontal (notice the prefix h(). It's common to use it with function selector.╛csound-expressionЎThe sample and hold widget. You can pick a value from the list of doubles. The original value is a head of the list (the first element). The visual grouping is vertical (notice the prefix v(). It's common to use it with function selector.ґcsound-expressionThe matrix of unipolar knobs.'knobPad columnNum rowNum names initValsщIt takes in the dimensions of matrix, the names (we can leave it empty if names are not important) and list of init values. It returns a function that takes in indices and produces the signal in the corresponding cell.ўcsound-expressionThe matrix of toggle buttons.)togglePad columnNum rowNum names initValsУIt takes in the dimensions of matrix, the names (we can leave it empty if names are not important) and list of init values (on/off booleans). It returns a function that takes in indices and produces the event stream in the corresponding cell.╞csound-expressionThe matrix of buttons. buttonPad columnNum rowNum namesкIt takes in the dimensions of matrix, the names (we can leave it empty if names are not important). It returns a function that takes in indices and produces the event stream in the corresponding cell.╟csound-expression⌠A generic constructor for matrixes of sound source widgets. It takes the constructor of the widget, a default initial value, the dimensions of the matrix, the list of names and the list of initial values. It produces the function that maps indices to corresponding values.╠csound-expressionHorizontal radio group.╡csound-expressionVertical radio group.Ёcsound-expressionHorizontal radio group.Єcsound-expressionVertical radio group.╣csound-expressionФCreates a knob that outputs only integers in the given range. It produces a signal of integer values.rangeKnobSig (min, max) initValІcsound-expressionХCreates a slider that outputs only integers in the given range. It produces a signal of integer values.!rangeSliderSig (min, max) initValЇcsound-expression≥Creates a knob that outputs only integers in the given range. It produces an event stream of integer values. It can be used with list access functions listAt, atTuple, atArg.%rangeKnob needInit (min, max) initVal█The first argument is a boolean. If it's true than the initial value is put in the output stream. If its False the initial value is skipped.╦csound-expression⌡Creates a slider that outputs only integers in the given range. It produces an event stream of integer values. It can be used with list access functions listAt, atTuple, atArg.'rangeSlider needInit (min, max) initVal█The first argument is a boolean. If it's true than the initial value is put in the output stream. If its False the initial value is skipped.╧csound-expressionЫ2d range range slider. Outputs a pair of event streams. Each stream contains changes in the given direction (Ox or Oy)./rangeJoy needsInit rangeX rangeY (initX, initY)█The first argument is a boolean. If it's true than the initial value is put in the output stream. If its False the initial value is skipped.╨csound-expressionЦ2d range range slider. It produces a single event stream. The event fires when any signal changes.0rangeJoy2 needsInit rangeX rangeY (initX, initY)█The first argument is a boolean. If it's true than the initial value is put in the output stream. If its False the initial value is skipped.╩csound-expression>2d range range slider. It produces the pair of integer signals╪csound-expressionIt's like simple buttonч, but it can be controlled with external control. The first argument is for external control.Ґcsound-expressionIt's like simple toggleч, but it can be controlled with external control. The first argument is for external control.©csound-expressionIt's like simple uknobч, but it can be controlled with external control. The first argument is for external control.юcsound-expressionIt's like simple usliderч, but it can be controlled with external control. The first argument is for external control.аcsound-expressionIt's like simple knobч, but it can be controlled with external control. The first argument is for external control.бcsound-expressionIt's like simple sliderч, but it can be controlled with external control. The first argument is for external control.цcsound-expressionIt's like simple hradioSigч, but it can be controlled with external control. The first argument is for external control.дcsound-expressionIt's like simple vradioSigч, but it can be controlled with external control. The first argument is for external control.еcsound-expressionIt's like simple hradioч, but it can be controlled with external control. The first argument is for external control.фcsound-expressionIt's like simple vradioч, but it can be controlled with external control. The first argument is for external control.аЛ М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐╙ ╘ ╗ Й И Х Г Ф Е Д Ц Б А Ю ъ ч щ э ш з ы ь в ж у т с р я п о н м л к й и х г ф е д ц б а ю © Ў Ґ ╪ ╩ ╨ ╧ ╦ Ї І ╣ Є Ё ╡ ╠ ╟ ╞ ў ґ ╛ ╚ К М Н О В ┤┬┴┼▀⌠▓▒░≈√∙■ ≥≤⌡╛╚╙╘╗╟╞ўґЄЁ╡╠кйихгфедцбаю©ЎҐ╪╩╨╧╦ыьвжу²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефа≈√∙■⌡ ≥≤⌠▓▒░▀┼┴┬┤│┌─Ъ ╛╚╙╘╗К Ч Щ Э ╟╞ўґО Ш ЄЁ╡╠Н З кйихгфедцбаю©ЎҐ╪╩╨╧╦В Ы ыьвжуМ Ь Ж В У Т С ·÷═║Р Я Н М О П ┐╙ ╘ ╗ Й И Х Г Ф Е Д Ц Б А Ю ъ ч щ э ш з ы ь в ж у т с р я п о н м л к й и х г ф е д ц б а ю © Ў Ґ ╪ ╩ ╨ ╧ ╦ Ї І ╣ Є Ё ╡ ╠ ╟ ╞ ў ґ ╛ ╚ Л ╒ёє╔ї╘і╗╙╠╡ЁЄ╚╛²Ї╦╣І╧╨╩ґў╞╟╪ҐЎаб©юефцдNone >?юабивъ╪&гcsound-expression6Creates a window with the given name, size and contentwin name (width, height) guiиcsound-expressionHides the SE inside Source.лcsound-expressionжResizes all default minimal sizes for all elements in the source. It affects the total sizes of the widgets. So for example if our UI is too big and it doesn't fir to the screen we can make it smaller by scaling:!resizeSource (0.75, 0.5) uiSourceмcsound-expressionфGroups a list of Source-widgets. The visuals are horizontally aligned.нcsound-expressionдGroups a list of Source-widgets. The visuals are vertically aligned.оcsound-expressionЖGroups a list of Source-widgets. The visuals are put on the grid. The first argument is numer of elements i each row.пcsound-expressionХGroups a list of Source-widgets. The visuals are horizontally aligned. It uses the list of proportions.яcsound-expressionФGroups a list of Source-widgets. The visuals are vertically aligned. It uses the list of proportions.рcsound-expressionThe shortcut for mapSource.сcsound-expressionЖCombines two sound sources. Visuals are aligned horizontally and the sound sources a grouped with the given function.тcsound-expressionТCombines two sound sources. Visuals are aligned vertically and the sound sources a grouped with the given function.уcsound-expressionIt's just like the hlift2> but two more parameters change visual scaling of the widgets.жcsound-expressionIt's just like the vlift2> but two more parameters change visual scaling of the widgets.вcsound-expressionThe same as hlift2 but for three sound sources.ьcsound-expressionThe same as vlift2 but for three sound sources.ыcsound-expressionThe same as hlift2' but for three sound sources.зcsound-expressionThe same as vlift2' but for three sound sources.шcsound-expressionThe same as hlift2 but for four sound sources.эcsound-expressionThe same as vlift2 but for four sound sources.щcsound-expressionThe same as hlift2' but for four sound sources.чcsound-expressionThe same as vlift2' but for four sound sources.ъcsound-expressionThe same as hlift2 but for five sound sources.Юcsound-expressionThe same as vlift2 but for five sound sources.Аcsound-expressionThe same as hlift2' but for five sound sources.Бcsound-expressionThe same as vlift2' but for five sound sources.Цcsound-expression6Monadic bind with horizontal concatenation of visuals.Дcsound-expression4Monadic bind with vertical concatenation of visuals.Еcsound-expression7Monadic apply with horizontal concatenation of visuals.Фcsound-expression5Monadic apply with vertical concatenation of visuals.Гcsound-expressionЖMonadic bind with horizontal concatenation of visuals. It expects scaling factors for visuals as first two arguments.Хcsound-expressionТMonadic bind with vertical concatenation of visuals. It expects scaling factors for visuals as first two arguments.Иcsound-expressionВMonadic apply with horizontal concatenation of visuals. It expects scaling factors for visuals as first two arguments.Йcsound-expressionУMonadic apply with vertical concatenation of visuals. It expects scaling factors for visuals as first two arguments.Кcsound-expressionоCreates a list of sources with mapping a function and stacks them horizontally.Лcsound-expressionмCreates a list of sources with mapping a function and stacks them vertically.Мcsound-expression It's like hmapM. but we can supply the list of relative sizes.Нcsound-expression It's like hvapM. but we can supply the list of relative sizes.Оcsound-expression┐Creates a list of sources with mapping a function and puts them on the grid. The first argument is the number of items in the row.нЙ К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡╙ ╘ ╗ Й ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г И Х К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄▐▌█⌠▓▒░≈√∙■ ≥≤⌡╒°²÷═·║їёєі╔╛╗╘╚╙╟ґ╞ўЄ╠Ё╡ЇІ╣к╦╧╨╩╪ҐЎ©юабцдефгхйитлмнопясрыужьвзЙшэщчъЮАБЦДЕФГИХцбЎ©аю≤²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНО┌├≈■∙√≤≥⌡ ┬├┤└┘Й К █▄▀┼┴ийкл▒г⌠▐░х▓▌Л П Я Р С Т У Ж Ь Ы З Ш ▄▐▌█╒°²÷═·║їёєі╔ЇІ╣тлмнопясрЙшэщчъЮАБЦДЕФГИХцбЎ©аюмнорствьшэъЮпяужызщчАБЦДЕФКЛГХИЙМНОNone>юЛ╚Шcsound-expressionRenders Csound file.Эcsound-expression0Render Csound file and save it to the give file.Щcsound-expression=Render Csound file with options and save it to the give file.Чcsound-expression9Render Csound file and save result sound to the wav-file.Ъcsound-expressionфRender Csound file with options and save result sound to the wav-file.─csound-expressionЯRenders Csound file, saves it to the given file, renders with csound command and plays it with the given program.playCsd program file csdProduces files file.csd (with <=) and file.wav (with csound) and then invokes:program "file.wav"│csound-expressionWorks just like <># but you can supply csound options.┌csound-expressionRenders csound code to file tmp.csd with flags set to -odac, -iadc and -Ma0 (sound output goes to soundcard in real time).┐csound-expression? with options.└csound-expression)Output to dac with virtual midi keyboard.┘csound-expressionюOutput to dac with virtual midi keyboard with specified options.├csound-expressionRenders to file tmp.csd and invokes the csound on it.┤csound-expressionRenders to file tmp.csd and invokes the csound on it.┬csound-expression6Renders to tmp.csd and tmp.wav and plays with mplayer.┴csound-expression6Renders to tmp.csd and tmp.wav and plays with mplayer.┼csound-expression;Renders to tmp.csd and tmp.wav and plays with totem player.▀csound-expression;Renders to tmp.csd and tmp.wav and plays with totem player.▄csound-expressionЭRuns the csound files with cabbage engine. It invokes the Cabbage command line utility and setts all default cabbage flags.█csound-expression√Runs the csound files with cabbage engine with user defined options. It invokes the Cabbage command line utility and setts all default cabbage flags.▌csound-expression3Alias to process inputs of single input audio-card.▐csound-expression3Alias to process inputs of stereo input audio-card.░csound-expression4Alias to process inputs of audio-card with 4 inputs.▒csound-expression4Alias to process inputs of audio-card with 6 inputs.▓csound-expression4Alias to process inputs of audio-card with 8 inputs.#Б ё є ╔ ТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓#ТУЖВЬЫЗШЭЩЧЪ─│┬┴┼▀┌┐└┘├┤Б ▄█▌▐░▒▓╔ є ё @NoneМTЎбдъД Е Ф Г С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ї і Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡гхийклмнопярсжутвьЕФГХИЙКЛМНОПЯРСі ї ╙ ╘ ╗ Й ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г И Х К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄▐▌█⌠▓▒░≈√∙■ ≥≤⌡╒°²÷═·║їёєі╔╛╗╘╚╙╟ґ╞ўЄ╠Ё╡ЇІ╣к╦╧╨╩╪ҐЎ©юабцдефгхйитлмнопясрыужьвзЙшэщчъЮАБЦДЕФГИХцбЎ©аюЛМНОТСПРЯУЖ≤≥ ⌡°²·²÷═║╒║ёє╔єёє╔іїі╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦФДЕГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОNoneлкёcsound-expression2Scaling factor for pitch. The 1 is inherent pitch.єcsound-expression2Scaling factor for tempo. The 1 is inherent tempo.╔csound-expression╙Fidelity corresponds to the size of the FFT-window that is used by functions of RAM-family. The function performs the FFT transform and it has to know the size. It's not the value for the size it's an integer value that proportional to the size. The higher the value the higher the size the lower the value the lower the size. The default value is 0. Zero is best for most of the cases. For drums we can lower it to (-2).╨PS: here is the formula for window size: 2 ** (fidelity + 11). So the fidelity is actually the degree for power of two. The FFT-algorithm requires the window size to be a power of two.аThe lower fidelity is the less power is consumed by the function.іcsound-expressionыLooping phasor. It creates a looping pointer to the file. It's used in the function ram.ЙTher arguments are: file name, start and end of the looping segment (in seconds), and the playback speed.╛csound-expressionThe sample format.ґcsound-expression,32-bit floating point samples without headerўcsound-expression16-bit integers without header╞csound-expressionп16-bit integers with a header. The header type depends on the render (-o) format╟csound-expressionu-law samples with a header╠csound-expression16-bit integers with a header╡csound-expression32-bit integers with a headerЁcsound-expression32-bit floats with a headerЄcsound-expression%8-bit unsigned integers with a header╣csound-expression24-bit integers with a headerІcsound-expression64-bit floats with a header╩csound-expressionкTakes only given amount (in seconds) from the signal (the rest is silence).╪csound-expression0Delays signals by the given amount (in seconds).Ґcsound-expressionШDelays a signal by the first argument and takes only second argument amount of signal (everything is measured in seconds).Ўcsound-expression)Repeats the signal with the given period.©csound-expressionтPlays the first signal for some time (in seconds) and then switches to the next one.afterSnd dur sig1 sig2юcsound-expressionХCreates a sequence of signals. Each segment lasts for fixed amount of time given in the first argument.аcsound-expression┘Creates a sequence of signals and loops over the sequence. Each segment lasts for fixed amount of time given in the first argument.бcsound-expression1Converts stereosignal to mono with function mean.цcsound-expression$Length in seconds of the sound file.дcsound-expression;Produces repeating segments with the given time in seconds.еcsound-expression=Reads stereo signal from the sound-file (wav or mp3 or aiff).фcsound-expressionНReads stereo signal from the sound-file (wav or mp3 or aiff) and loops it with the given period (in seconds).гcsound-expressionЮReads stereo signal from the sound-file (wav or mp3 or aiff) and loops it with the file length.хcsound-expression┌Reads the wav file with the given speed (if speed is 1 it's a norma playback). We can use negative speed to read file in reverse.иcsound-expression$Reads th wav file and loops over it.йcsound-expressionReads a segment from wav file.кcsound-expression╗Reads the wav file with the given speed (if speed is 1 it's a norma playback). We can use negative speed to read file in reverse. Scales the tempo with first argument.лcsound-expressionйReads th wav file and loops over it. Scales the tempo with first argument.мcsound-expression!The mono variant of the function readSnd.нcsound-expression!The mono variant of the function loopSndBy.оcsound-expression!The mono variant of the function loopSnd.пcsound-expression!The mono variant of the function readWav.яcsound-expression!The mono variant of the function loopWav.рcsound-expressionReads a segment from wav file.сcsound-expressionґReads the mono wav file with the given speed (if speed is 1 it's a norma playback). We can use negative speed to read file in reverse. Scales the tempo with first argument.тcsound-expressionоReads th mono wav file and loops over it. Scales the tempo with first argument.уcsound-expressionбLoads the sample in the table. The sample should be short. The size of the table is limited. It's up to 3 minutes for 44100 sample rate (sr), 2.9 minutes for 48000 sr, 1.4 minutes for 96000 sr.жcsound-expressionбLoads the sample in the table. The sample should be short. The size of the table is limited. It's up to 6 minutes for 44100 sample rate (sr), 5.9 minutes for 48000 sr, 2.8 minutes for 96000 sr.вcsound-expressionРWrites a sound signal to the file with the given format. It supports only four formats: Wav, Aiff, Raw and Ircam.ьcsound-expressionWrites wav files.ыcsound-expressionяDumps signals to file and sends the audio through. Useful to monitor the signals.зcsound-expressionуDumps mono signal to file and sends the audio through. Useful to monitor the signals.шcsound-expressionWrites aiff files.эcsound-expression!Writes mono signals to wav files.щcsound-expression"Writes mono signals to aiff files.чcsound-expression=Mincer. We can playback a table and scale by tempo and pitch.#mincer fidelity table pointer pitch▒fidelity is the parameter that specifies the size of the window (for FFT transform). The size equals to formula (fidelity + 11) ^ 2. If you don't know what to choose choose 0 for pitched sounds and -2 for drums. The table contains the sample to playback. The pointer loops over the table. The pitch specifies a scaling factor for pitch. So we can raise tone an octave up by setting the pitch to 2.ъcsound-expressionцCreates a pointer signal for reading audio from the table in loops.lphase length start end speedArguments are:length of the table in seconds,start and end points of the reading intervalplayback speedЮcsound-expression Forces phasor to play only once.Аcsound-expressionReads the file forth and back.Бcsound-expression╨Creates a phasor if segments are relative to the total length. It can be useful for drum loops. If we don't know the complete length but we know that loop contains four distinct parts.Цcsound-expressionнCreates a phasor for reading the whole audio file in loops with given speed.Еcsound-expression╞Reads audio files in loops. The file is loaded in RAM. The size of the file is limited. It should be not more than 6 minutes for sample rate of 44100. 5.9 minutes for 48000.юWhat makes this function so cool is that we can scale the sound by tempo without affecting pitch, and we can scale the sound by pitch without affecting the tempo. Let's study the arguments.ram fidelity phasor pitch┌fidelity corresponds to the size of the FFT-window. The function performs the FFT transform and it has to know the size. It's not the value for the size it's an integer value that proportional to the size. The higher the value the higher the size the lower the value the lower the size. The default value is 0. Zero is best for most of the cases. For drums we can lower it to (-2).#The phasor is a quadruple of values/(Phsr fileName startTime endTime playbackSpeed)Вwe can read the file from startTime to endTime (in seconds) and we can set the speed for playback. If speed is negative file is played in reverse. The playback is looped. So to scale the tempo or play in reverse we can change the playbackSpeed.╔The last argument is pitch factor. We can rise by octave with factor 2. It's good place to use the function semitone. It produces factors for a number in semitones.╩Note that all parameters (except window size) are signals. It makes this function very flexible. We can change the speed of playback and start and end of the reading segment as we wish.!ram 0 (Phsr "file.wav" 0 1 1.2) 1=PS: here is the formula for window size: 2 ** (fidelity + 11)Фcsound-expression1Reads file once and scales it by tempo and pitch.Гcsound-expressionнLoop over file and scales it by tempo and pitch (it's based on mincer opcode).Хcsound-expressionЮReads a segment from file once and scales it by tempo and pitch. Segment is defined in seconds.Иcsound-expressionчLoops over a segment of file and scales it by tempo and pitch. Segment is defined in seconds.Йcsound-expressionЇReads a relative segment from file once and scales it by tempo and pitch. Segment is defined in seconds. The end ponits for the segment are relative to the total length of the file.Кcsound-expression╣Loops over a relative segment of file and scales it by tempo and pitch. Segment is defined in seconds. The end ponits for the segment are relative to the total length of the file.Лcsound-expressionThe mono version of readRam.Мcsound-expressionThe mono version of loopRam.Нcsound-expressionThe mono version of readSeg.Оcsound-expressionThe mono version of loopSeg.Пcsound-expressionThe mono version of readRel.Яcsound-expressionThe mono version of loopRel.Рcsound-expression3ScaleWav function with fidelity set for drum-loops.Сcsound-expression9ScaleWav function with fidelity set for hormonical-loops.Тcsound-expression4ScaleWav1 function with fidelity set for drum-loops.Уcsound-expression:ScaleWav1 function with fidelity set for hormonical-loops.Жcsound-expressionэScaling mono audio files (accepts both midi and wav). It's based on temposcal Csound opcode.Вcsound-expressionчScaling stereo audio files (accepts both midi and wav). It's based on temposcal Csound opcode.в▀▌ёє╔ії╗╘╙╚╛╠╡ґў╞╟ЁЄ╣ІЇ╧╦╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВвегфхийлкмонпяртсЇ╧╦╨ужч▌▀ії╗╘╙╚ъБЦАЮЕД╔єёФГХИЙКЛМНОПЯРСТУЖВ╛╠╡ґў╞╟ЁЄ╣Івьшэщызцд╩╪©юаҐЎб!NoneивЮnЧcsound-expressionИA segment of the signal. The signal segment is a limited span of signal in time. The time can be measured in seconds or in events! The time span which is measured in events is the first occurence of the event in the event stream.їThere are handy functions for scheduling the signal segments. we can delay the segment or loop over it or limit it with tme interval or play a sequence of segments. The main feature of the segments is the ability to schedule the signals with event streams (like button clicks or midi-events).Ъcsound-expressionдConverts signals to segments. The segment is not limited in length.─csound-expressionаLimits the length of the segment with constant length in seconds.│csound-expressionбLimits a signal with an event stream and retriggers it after stop.┌csound-expressionConverts segments to signals.┐csound-expression>A pause. Plays nothing for the given time interval in seconds.└csound-expression5Delays a segment by a given time interval in seconds.ЧЪ─│┌┐└ЧЪ┌─└┐│"None1С▐csound-expressionрTriggers the signal with the first stream and turns it off with the second stream.▓csound-expressionдConsider note limiting? or performance degrades every note is held to infinity and it continues to produce zeroes. No it's not every sequence note triggers it but it's best to limit them anyway■csound-expressionОPlays a list signals. It triggers the signal with event stream and silences all the rest in the list so that only one signal is playing. We can create simple costum monosynthes with this function. The last event stream stops all signals.√csound-expression7Triggers one signal after another with an event stream.≈csound-expression7Triggers one signal after another with an event stream.≤csound-expression²Triggers a signal when one of the chars from the first string is pressed. Stops signal from playing when one of the chars from the second string is pressed.≥csound-expressionяTriggers a signal when one of the chars from the first string is pressed. Stops signal from playing when one of the chars from the second string is pressed. Synchronizes the signal with bpm (first argument). csound-expression&Plays a signal while a key is pressed.⌡csound-expressionлPlays a signal while a key is pressed. Synchronized by BPM (first argument).°csound-expression'Toggles the signal when key is pressed.²csound-expressionнToggles the signal when key is pressed. Synchronizes by BPM (first argument).═csound-expression·Plays a list of signals when corresponding key is pressed. Turns off all other signals in the group. The last string is for stopping the group from playing.║csound-expressionнPlays a list of signals when corresponding key is pressed. Turns off all other signals in the group. The last string is for stopping the group from playing. Events are syncronized by BPM (first argument).╒csound-expression└Plays signals one after another when key is pressed. Stops the group from playing when the char from the last argument is pressed.ёcsound-expressionІPlays signals one after another when key is pressed. Stops the group from playing when the char from the last argument is pressed. Events are syncronised with BPM (first argument).єcsound-expression%Scales the signal with the amplitude.╔csound-expressionҐApplies a low pass filter to the signal. The first two arguments are the frequency range for center frequency of the filter and the second one is amount of resonance (ranges from 0 to 1).іcsound-expression6the midiLpInstr with audio range for center frequency.їcsound-expression=Ignores the amplitude and justplays back the original signal.╗csound-expression²Plays a signal when the key is pressed. Retriggers the signal when the key is pressed again. The key is an integer midi code. The C1 is 60 and the A1 is 69.╘csound-expressionыPlays a signal when the key is pressed. Retriggers the signal when the key is pressed again. Turns off the signal after specified duration (n seconds). The key is an integer midi code. The C1 is 60 and the A1 is 69.╙csound-expressionИPlyas a signal while the key is pressed. The key is an integer midi code. The C1 is 60 and the A1 is 69.╚csound-expressionМPlays and stops a signal in the toggle mode. The key is an integer midi code. The C1 is 60 and the A1 is 69.╛csound-expression▐Plays a set of signals on the list of keys. When certain key is pressed the corresponding signal starts to play and all the rest are stopped.а- The key is an integer midi code. The C1 is 60 and the A1 is 69.ґcsound-expressionЕThe generic midiTrig. We can specify the midi function. The midi function takes in a signal and a volume of the pressed key (it ranges from 0 to 1). It produces some output. The default is scaling the signal with the amplitude.ўcsound-expressionДThe generic midiTap. We can specify the midi function. The midi function takes in a signal and a volume of the pressed key (it ranges from 0 to 1). It produces some output. The default is scaling the signal with the amplitude.╞csound-expressionЕThe generic midiPush. We can specify the midi function. The midi function takes in a signal and a volume of the pressed key (it ranges from 0 to 1). It produces some output. The default is scaling the signal with the amplitude.╟csound-expressionГThe generic midiToggle. We can specify the midi function. The midi function takes in a signal and a volume of the pressed key (it ranges from 0 to 1). It produces some output. The default is scaling the signal with the amplitude.╠csound-expressionФThe generic midiGroup. We can specify the midi function. The midi function takes in a signal and a volume of the pressed key (it ranges from 0 to 1). It produces some output. The default is scaling the signal with the amplitude./▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪/▐▓■√░⌠∙≈≤· °═╒≥÷⌡²║ё▒╗╘╙╚╛ґў╞╟╠▌є╔ії╡ЁЄ╣ІЇ╦╧╨╩╪None5ЛҐcsound-expression+The same as headPan but for stereo signals.Ўcsound-expression,The same as headPan' but for stereo signals.©csound-expression1The same as staticHeadPan but for stereo signals.юcsound-expressionЛNet of sounds evenly distributed oround the head. First argument is a pair of numbers (column, rows) in the matrix. The second argument is a matrix written in a single list. The rows are for elevation and the columns are for azimuth.A ghci session example:Юlet f t x = mul 0.4 $ sched (\_ -> return $ fades 0.07 0.1 * tri x) $ withDur 0.2 $ metro t dac $ headPanNet (3, 2) [f 1 220, f 0.75 330, f 0.5 440, f 0.2 660, delaySnd 0.75 $ f 2 (220 * 5/4),delaySnd 0.4 $ f 1 (220 * 9/8)]аcsound-expression.The same as headPanNet but for stereo signals.°²·╒║═÷ҐЎ©юа╒║═÷²°·ҐЎ©юа#Nonepu8бcsound-expression Defaults for fof2 opcode.лcsound-expression/Sndwarp secondary parameters. It's instance of Default, we can use the constant def to get the value.WinSizeл - window size in seconds (not in samples as in Csound!). The default is 0.1Randwю - the bandwidth of a random number generator. The random numbers will be added to iwsize. It's measured in ratio to WinSize. So the 1 means the one WinSize length. The default is 0.3OverlapФ - determines the density of overlapping windows. The default value is 50. It's in range (0 to 100)рcsound-expression6Randomized parameters for arguments (in range 0 to 1).вcsound-expression#Secondary parameters for syncgrain.Win8 -- grain window function (half-sine is used by default)Overlapц -- grain overlap (use values in range 0 to 100, the 25 is default)шcsound-expressionSecondary parameters for granule. We can use the def to get the defaults. Gap - gap between grains in sec.пVoice - number of voices (integer value in magnitude of 1 to 128, 64 is default)ГRatio - ratio of the speed of the gskip pointer relative to output audio sample rate (the default is 1)Mode - playback mode (see GranuleMode, play forward is the default)сSkip_os - gskip pointer random offset in sec, 0 will be no offset (0.5 is default).БGap_os - gap random offset in ratios (0 to 1) of the gap size, 0 gives no offset (0.5 is default).ГSize_os -grain size random offset in ratios (0 to 1) of grain size, 0 gives no offset (0.5 is default).=Seed - seed for the random number generator (0.5 is default).ьAtt - attack of the grain envelope in ratios (0 to 1) of grain size (0.3 is default).уDec - decay of the grain envelope in ratios (0 to 1) of grain size (0.3 is default).Гcsound-expressionGranule playback mode.Кcsound-expression#Randomized parameters for function grainy°. We can randomize pitch scaleing factor (0 to 1), read position (in ratio: 0 to 1), and duration of the grains (in seconds, in magnitude of 0.005 to 0.5).Пcsound-expression>Secondary parameters for the partikkel opcode. We can use the defн to get the defaults. See the official docs to know the complete description:csound doc: 1http://www.csounds.com/manual/html/partikkel.html▐csound-expression©Granular synthesizer with "per grain" control over many of its parameters. Has a sync input to sychronize its internal grain scheduler clock to an external clock source.юpartikkel was conceived after reading Curtis Roads' book Microsound═, and the goal was to create an opcode that was capable of all time-domain varieties of granular synthesis described in this book. The idea being that most of the techniques only differ in parameter values, and by having a single opcode that can do all varieties of granular synthesis makes it possible to interpolate between techniques. Granular synthesis is sometimes dubbed particle synthesis, and it was thought apt to name the opcode partikkel to distinguish it from other granular opcodes.:partikkel spec grainrate grainsize kpitch ifiltabs apntersspec - secondary parameters grainrate - rate of the grain creation grainsize5 - grain size in sec (!!!not in ms as for Csound!!!).kpitch -- pitch scaling factor.apnters1 -- list of pointers (up to 4 values can be used)ifiltabs/ -- list of tables (up to 4 values can be used)░csound-expression?Simplified version of partikkel. The partikkel for mono sounds.2grainy1 speed grainrate grainsize kfreqFactor filespeed - speed of the playback grainrate - rate of the grain creation grainsize - size of the grainsfile0 - filename of an audio file to read the grains.▒csound-expressionаSimplified version of partikkel. The partikkel for stereo sounds.2grainy1 speed grainrate grainsize kfreqFactor filespeed - speed of the playback grainrate - rate of the grain creation grainsize - size of the grainsfile0 - filename of an audio file to read the grains.▓csound-expressionRandomized version of grainy1.⌠csound-expressionRandomized version of grainy.■csound-expressionЮSimplified version of partikkel with pointer access to the table. The partikkel for mono sounds.4ptrGrainy grainrate grainsize kfreqFactor tab apnterspeed - speed of the playback grainrate - rate of the grain creation grainsize - size of the grainstab - table with sampled sound.apnterд - pointer to the table. pointer is relative to total size (0 to 1).∙csound-expressionЮSimplified version of partikkel with pointer access to the table. The partikkel for mono sounds.4ptrGrainy grainrate grainsize kfreqFactor tab apnterspeed - speed of the playback grainrate - rate of the grain creation grainsize - size of the grainsfile - file with sampled sound.apnter" - pointer to the table in seconds√csound-expressionЮSimplified version of partikkel with pointer access to the table. The partikkel for mono sounds.4ptrGrainy grainrate grainsize kfreqFactor tab apnterspeed - speed of the playback grainrate - rate of the grain creation grainsize - size of the grainsfile - file with sampled sound.apnter" - pointer to the table in seconds≈csound-expressionRandomized version of ptrGrainy.≤csound-expression4A more complex granular synthesis texture generator.зgranule is a Csound unit generator which employs a wavetable as input to produce granularly synthesized audio output. Wavetable data may be generated by any of the GEN subroutines such as GEN01 which reads an audio data file into a wavetable. This enable a sampled sound to be used as the source for the grains. Up to 128 voices are implemented internally. The maximum number of voices can be increased by redefining the variable MAXVOICE in the grain4.h file. granule has a build-in random number generator to handle all the random offset parameters. Thresholding is also implemented to scan the source function table at initialization stage. This facilitates features such as skipping silence passage between sentences.!granule spec chord grainSize ftabspec% -- secondary parameters. We can use def to get the defaults.chord :: [D]≤ -- the list of pitch factors to scale the original sound. It can be up to 4 items long. This parameters allows us to create a chords out of grains. grainSize -- grain size in sec.ftab - table with sampled sound.≥csound-expressiongranuleХ that is defined on stereo audio files. We provide the filename instead of table. The rest is the same. csound-expressiongranuleФ that is defined on mono audio files. We provide the filename instead of table. The rest is the same.⌡csound-expressionSynchronous granular synthesis.▀syncgrain implements synchronous granular synthesis. The source sound for the grains is obtained by reading a function table containing the samples of the source waveform. For sampled-sound sources, GEN01 is used. syncgrain will accept deferred allocation tables.4syncgrain spec graidDuration timeScale PitchSig ftabspec - secondary params (use def to get the defaults) graidDuration! - duration of grains in seconds. timeScale - tempo scaling factor.PitchSig - pitch scaling factor.ftab - table with sampled sound.°csound-expression)The syncgrain with randomized parameters.²csound-expressionЯsyncgrain that is defined on stereo audio files. We provide the filename instead of table. The rest is the same.·csound-expressionОsyncgrain that is defined on mono audio files. We provide the filename instead of table. The rest is the same.÷csound-expressionТrndSyncgrain that is defined on stereo audio files. We provide the filename instead of table. The rest is the same.═csound-expressionРrndSyncgrain that is defined on mono audio files. We provide the filename instead of table. The rest is the same.║csound-expression:Simple sndwarp with scaling mode (corresponds to Csound's initmode == 0). sndwarp spec resample speed ftabspec - secondary params (use def to get the defaults)resampleи - the factor by which to change the pitch of the sound. For example, a value of 2 will produce a sound one octave higher than the original. The timing of the sound, however, will not be altered.speed9 - the factor by which to change the tempo of the sound.ftab -- table with the samples╒csound-expressionStereo version of the sndwarp.ёcsound-expressionОSndwarp that is defined on stereo audio files. We provide the filename instead of table. The rest is the same.єcsound-expressionМSndwarp that is defined on mono audio files. We provide the filename instead of table. The rest is the same.╔csound-expression(The simple sndwarp with pointer (Csound initmode = 1).sndwarp spec resample ftab ptrspec - secondary params (use def to get the defaults)resampleи - the factor by which to change the pitch of the sound. For example, a value of 2 will produce a sound one octave higher than the original. The timing of the sound, however, will not be altered.ftab -- table with the samplesptr+ - pointer to read the table (in seconds).іcsound-expressionStereo version of ptrSndwarp.їcsound-expressionРptrSndwarp that is defined on stereo audio files. We provide the filename instead of table. The rest is the same.╗csound-expressionПptrSndwarp that is defined on mono audio files. We provide the filename instead of table. The rest is the same.╘csound-expression8Reimplementation of fof2 opcode for stereo audio files.╙csound-expression5Reimplementation of fof2 opcode for mono audio files.╚csound-expression Reimplementation of fof2 opcode.╛csound-expressionгGranular delay effect for fof2. Good values for grain rate and size aregrainRate = 25 grainSize = 2.5ґcsound-expressionGranular delay effect for grainy.ўcsound-expressionGranular delay effect for rndGrainy.╞csound-expressionGranular delay effect for sndwarp.╟csound-expressionGranular delay effect for syncgrain.╠csound-expressionGranular delay effect for rndSyncgrain.╡csound-expressionGranular delay effect for partikkel.Ёcsound-expressionGranular effect for grainy.Єcsound-expressionGranular effect for rndGrainy.╣csound-expressionGranular effect for sndwarp.Іcsound-expressionGranular effect for syncgrain.Їcsound-expressionGranular effect for rndSyncgrain.╦csound-expressionGranular effect for partikkel.╧csound-expressionGranular effect for fof2.╨csound-expression©Granular synthesizer with "per grain" control over many of its parameters. Has a sync input to sychronize its internal grain scheduler clock to an external clock source.юpartikkel was conceived after reading Curtis Roads' book Microsound═, and the goal was to create an opcode that was capable of all time-domain varieties of granular synthesis described in this book. The idea being that most of the techniques only differ in parameter values, and by having a single opcode that can do all varieties of granular synthesis makes it possible to interpolate between techniques. Granular synthesis is sometimes dubbed particle synthesis, and it was thought apt to name the opcode partikkel to distinguish it from other granular opcodes.Ёa1 [, a2, a3, a4, a5, a6, a7, a8] partikkel agrainfreq, \ kdistribution, idisttab, async, kenv2amt, ienv2tab, ienv_attack, \ ienv_decay, ksustain_amount, ka_d_ratio, kduration, kamp, igainmasks, \ kwavfreq, ksweepshape, iwavfreqstarttab, iwavfreqendtab, awavfm, \ ifmamptab, kfmenv, icosine, ktraincps, knumpartials, kchroma, \ ichannelmasks, krandommask, kwaveform1, kwaveform2, kwaveform3, \ kwaveform4, iwaveamptab, asamplepos1, asamplepos2, asamplepos3, \ asamplepos4, kwavekey1, kwavekey2, kwavekey3, kwavekey4, imax_grains \ [, iopcode_id]csound doc: 1http://www.csounds.com/manual/html/partikkel.html╩csound-expressionSynchronous granular synthesis.┼syncgrain implements synchronous granular synthesis. The source sound for the grains is obtained by reading a function table containing the samples of the source waveform. For sampled-sound sources, GEN01 is used. syncgrain will accept deferred allocation tables.вasig syncgrain kamp, kfreq, kpitch, kgrsize, kprate, ifun1, \ ifun2, iolapscsound doc: 1http://www.csounds.com/manual/html/syncgrain.html╪csound-expression4A more complex granular synthesis texture generator.жThe granule unit generator is more complex than grain, but does add new possibilities.Еares granule xamp, ivoice, iratio, imode, ithd, ifn, ipshift, igskip, \ igskip_os, ilength, kgap, igap_os, kgsize, igsize_os, iatt, idec \ [, iseed] [, ipitch1] [, ipitch2] [, ipitch3] [, ipitch4] [, ifnenv]csound doc: /http://www.csounds.com/manual/html/granule.htmlҐcsound-expressionщReads a mono sound sample from a table and applies time-stretching and/or pitch modification.Хsndwarp reads sound samples from a table and applies time-stretching and/or pitch modification. Time and frequency modification are independent from one another. For example, a sound can be stretched in time while raising the pitch!Сares [, ac] sndwarp xamp, xtimewarp, xresample, ifn1, ibeg, iwsize, \ irandw, ioverlap, ifn2, itimemodecsound doc: /http://www.csounds.com/manual/html/sndwarp.htmlЎcsound-expressionъReads a stereo sound sample from a table and applies time-stretching and/or pitch modification.Яsndwarpst reads stereo sound samples from a table and applies time-stretching and/or pitch modification. Time and frequency modification are independent from one another. For example, a sound can be stretched in time while raising the pitch!│ar1, ar2 [,ac1] [, ac2] sndwarpst xamp, xtimewarp, xresample, ifn1, \ ibeg, iwsize, irandw, ioverlap, ifn2, itimemodecsound doc: 1http://www.csounds.com/manual/html/sndwarpst.htmlЩбцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎЩ▌█▄▀КЛМНО▒░⌠▓■≈∙√лмнопя║╒ёє╔ії╗вьызрстуж⌡²·°÷═шэщчъЮАБЦДЕФГХИЙ≤≥ ПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▐бцдефгхийк╚╘╙ґў╞╟╠╡╛ЁЄ╣ІЇ╦╧ҐЎ╩╪╨$None~ гcsound-expressionУSpecification of morphing synth. It has the default instance and the values in its records has default instances tooкcsound-expressionParameters for grain envelope.4attShape -- table that contains shape of the attack.2decShape -- table that contains shape of the decayбsustRatio -- how big is sustain phase relative to attack and decayЮattack to decay ration -- relative amount of attack decay ration. 0.5 means attack equals decay.цsee docs for Csound partikkel opcode for more detailed information 1http://www.csounds.com/manual/html/partikkel.htmlяcsound-expressionDensity of the grain stream.rate+ is how many grains per second is generatedsizeв is the size of each grain in milliseconds (it's good to set it relative to grain rate)skipШ skip is a skip ratio (0 to 1). It's the probability of grain skip. Zero means no skip and 1 means every grain is left out.цsee docs for Csound partikkel opcode for more detailed information 1http://www.csounds.com/manual/html/partikkel.htmlыcsound-expressionЧSynth that is based on partikkel. It allows easy morphing between unlimited number of waves. While partikkel allows only 4 waves to be used. We can use as many as we like. Internally the list is split on groups 4 elements or less in each and one partikkel is applied to each group. Many parameters of partikel were simplified to get the good defaults for sound morphing behavior."morpheus spec waves frequencyScale%spec -- contains many misc parametersбwaves list can contain up to four wave tables to read grains from.ІfrequencyScale -- scaling factor for frequency. 1 means playing at the original frequency, 2 rises the pitch by octave. We can use negative values to play the grains in reverse.зcsound-expression╠Creates four control signals out two signals. The control signals are encoded by the position of the point on XY-plane. The four resulting signals are derived from the proximity of the point to four squares of the ((0, 1), (0, 1)) square. It can be useful to control the morpheus with XY-pad controller.шcsound-expression├Morpheus synth for mono-audio files. The first cell in each tripple is occupied by file name. The rest arguments are the same as for morpheus.эcsound-expression┬Morpheus synth for stereo-audio files. The first cell in each tripple is occupied by file name. The rest arguments are the same as for morpheus.щcsound-expressionMorpheus oscillator.+morpheusOsc spec (baseFrequency, table) cps baseFrequencyЬ is the frequency of the sample contained in the table. With oscillator we can read the table on different frequencies.чcsound-expressionъMorpheus oscillator. We control the four tables with pair of control signals (see the function pairToSquare).6morpheusOsc2 spec baseFrequency waves (x, y) cps = ...гхийклмнопярстужвьызшэщчьвжгхийярстуклмнопышэзщчNone>юивЇтБcsound-expressionвA function transformer (decorator). We can transform an envelope producer so that all values and durations are sumed with some random value. The amplitude of the random value is given with the first two arguments.жIt can transform linseg, expseg, sequence producers and simplified sequence producers.An example:дdac $ mul (humanValTime 0.1 0.1 sqrSeq [1, 0.5, 0.2, 0.1] 1) $ whiteьAs you can see it transforms the whole function. So we don't need for extra parenthesis.Еcsound-expressionгA function transformer (decorator). We can transform an envelope producer so that all durations are sumed with some random value. The amplitude of the random value is given with the first argument.жIt can transform linseg, expseg, sequence producers and simplified sequence producers.An example:=dac $ mul (humanTime 0.1 sqrSeq [1, 0.5, 0.2, 0.1] 1) $ whiteьAs you can see it transforms the whole function. So we don't need for extra parenthesis.Хcsound-expressionдA function transformer (decorator). We can transform an envelope producer so that all values are sumed with some random value. The amplitude of the random value is given with the first argument.жIt can transform linseg, expseg, sequence producers and simplified sequence producers.An example:Makes time intervals relative to the note's duration. So that:onIdur [a, t1, b, t2, c]becomes:[a, t1 * idur, b, t2 * idur, c]Оcsound-expression>Makes time intervals relative to the note's duration. So that:onDur dt [a, t1, b, t2, c]becomes:[a, t1 * dt, b, t2 * dt, c]Пcsound-expressionThe opcode ABа with time intervals relative to the total duration of the note.Яcsound-expressionThe opcode ACа with time intervals relative to the total duration of the note.Рcsound-expressionThe opcode ABс with time intervals relative to the total duration of the note given by the user.Сcsound-expressionThe opcode ACс with time intervals relative to the total duration of the note given by the user.Тcsound-expressionThe opcode ADХ with time intervals relative to the total duration of the note. Total time is set to the value of idur.linendur asig rise decayУcsound-expressionThe opcode ADВ with time intervals relative to the total duration of the note. Total time is set to the value of the first argument.linendurBy dt asig rise decayЖcsound-expression$Fades in with the given attack time.Вcsound-expression%Fades out with the given attack time.Ьcsound-expression┘Slope envelope. It stays at zero for a given time then it raises to 1 for thre given time. The function is usefull to delay the LFO.slope zeroTime rizeTimeЫcsound-expression$Exponential slope (See the function slope).Зcsound-expression0Fades in by exponent with the given attack time.Шcsound-expression1Fades out by exponent with the given attack time.Эcsound-expression&A combination of fade in and fade out."fades attackDuration decayDurationЩcsound-expression2A combination of exponential fade in and fade out.%expFades attackDuration decayDurationЪcsound-expression3Sample and hold cyclic signal. It takes the list of[a, dta, b, dtb, c, dtc, ...]4the a, b, c, ... are values of the constant segmentsаthe dta, dtb, dtc, are durations in seconds of constant segments.юThe period of the repetition equals to the sum of all durations.─csound-expressionIt's just like linseg but it loops over the envelope.│csound-expressionIt's just like expseg but it loops over the envelope.┌csound-expressionнSample and hold sequence. It outputs the looping sequence of constan elements.┐csound-expression&Step sequencer with unipolar triangle.└csound-expression$Step sequencer with unipolar square.┘csound-expression&Step sequencer with unipolar sawtooth.├csound-expression,Step sequencer with unipolar inveted square.┤csound-expression.Step sequencer with unipolar inveted sawtooth.┬csound-expression2Step sequencer with unipolar exponential sawtooth.┴csound-expression;Step sequencer with unipolar inverted exponential sawtooth.┼csound-expression2Step sequencer with unipolar exponential triangle.▀csound-expressionВA sequence of unipolar waves with pulse width moulation (see upw). The first argument is a duty cycle in range 0 to 1.▄csound-expression─A sequence of unipolar inverted waves with pulse width moulation (see upw). The first argument is a duty cycle in range 0 to 1.█csound-expressionЪA sequence of unipolar triangle waves with ramp factor (see uramp). The first argument is a ramp factor cycle in range 0 to 1.▌csound-expression▀A sequence of unipolar exponential triangle waves with ramp factor (see uramp). The first argument is a ramp factor cycle in range 0 to 1.▐csound-expression┬A sequence of unipolar inverted triangle waves with ramp factor (see uramp). The first argument is a ramp factor cycle in range 0 to 1.░csound-expression■A sequence of unipolar inverted exponential triangle waves with ramp factor (see uramp). The first argument is a ramp factor cycle in range 0 to 1.▒csound-expressionйLooping sample and hold envelope. The first argument is the list of pairs: [a, durA, b, durB, c, durc, ...]сIt's a list of values and durations. The durations are relative to the period of repetition. The period is specified with the second argument. The second argument is the frequency of repetition measured in Hz.lpshold valDurs frequency▓csound-expressionйLooping linear segments envelope. The first argument is the list of pairs: [a, durA, b, durB, c, durc, ...]сIt's a list of values and durations. The durations are relative to the period of repetition. The period is specified with the second argument. The second argument is the frequency of repetition measured in Hz.loopseg valDurs frequency⌠csound-expressionоLooping exponential segments envelope. The first argument is the list of pairs: [a, durA, b, durB, c, durc, ...]сIt's a list of values and durations. The durations are relative to the period of repetition. The period is specified with the second argument. The second argument is the frequency of repetition measured in Hz.loopxseg valDurs frequency■csound-expressionвIt's like lpshold but we can specify the phase of repetition (phase belongs to [0, 1]).∙csound-expressionвIt's like loopseg but we can specify the phase of repetition (phase belongs to [0, 1]).√csound-expressionьIt's like loopxseg but we can specify the phase of repetition (phase belongs to [0, 1]).≈csound-expressionThe looping ADSR envelope.7xadsrSeq attack decay sustain release weights frequencyуThe sum of attack, decay, sustain and release time durations should be equal to one.≤csound-expression┘The looping exponential ADSR envelope. there is a fifth segment at the end of the envelope during which the envelope equals to zero.7xadsrSeq attack decay sustain release weights frequencyуThe sum of attack, decay, sustain and release time durations should be equal to one.≥csound-expression3The looping ADSR envelope with the rest at the end.;adsrSeq attack decay sustain release rest weights frequencyшThe sum of attack, decay, sustain, release and rest time durations should be equal to one. csound-expression┘The looping exponential ADSR envelope. there is a fifth segment at the end of the envelope during which the envelope equals to zero.=xadsrSeq_ attack decay sustain release rest weights frequencyшThe sum of attack, decay, sustain, release and rest time durations should be equal to one.⌡csound-expression*The looping sequence of constant segments.дlinSeg [a, durA, b, durB, c, durC, ...] [scale1, scale2, scale3] cpsыThe first argument is the list that specifies the shape of the looping wave. It's the alternating values and durations of transition from one value to another. The durations are relative to the period. So that lists*[0, 0.5, 1, 0.5, 0] and [0, 50, 1, 50, 0]яproduce the same results. The second list is the list of scales for subsequent periods. Every value in the period is scaled with values from the second list. The last argument is the rate of repetition (Hz).°csound-expression(The looping sequence of linear segments.дlinSeg [a, durA, b, durB, c, durC, ...] [scale1, scale2, scale3] cpsыThe first argument is the list that specifies the shape of the looping wave. It's the alternating values and durations of transition from one value to another. The durations are relative to the period. So that lists*[0, 0.5, 1, 0.5, 0] and [0, 50, 1, 50, 0]яproduce the same results. The second list is the list of scales for subsequent periods. Every value in the period is scaled with values from the second list. The last argument is the rate of repetition (Hz).²csound-expression-The looping sequence of exponential segments.дexpSeg [a, durA, b, durB, c, durC, ...] [scale1, scale2, scale3] cpsыThe first argument is the list that specifies the shape of the looping wave. It's the alternating values and durations of transition from one value to another. The durations are relative to the period. So that lists*[0, 0.5, 1, 0.5, 0] and [0, 50, 1, 50, 0]яproduce the same results. The second list is the list of scales for subsequent periods. Every value in the period is scaled with values from the second list. The last argument is the rate of repetition (Hz).·csound-expression Creates a÷csound-expression%Squashes a sequence to a single beat.═csound-expressionкSquashes a sequence to a single beat and then stretches to the given value.║csound-expression A sequence of constant segments.╒csound-expressionA linear sequence.ёcsound-expressionAn exponential sequence.єcsound-expressionэThe sequence of pulse width waves. The first argument is a duty cycle (ranges from 0 to 1).╔csound-expression+The sequence of inversed pulse width waves.іcsound-expressionThe sequence of square waves.їcsound-expression&The sequence of inversed square waves.╗csound-expressionThe sequence of sawtooth waves.╘csound-expression(The sequence of inversed sawtooth waves.╙csound-expression+The sequence of exponential sawtooth waves.╚csound-expression4The sequence of inversed exponential sawtooth waves.╛csound-expressionдThe sequence of ramp functions. The first argument is a duty cycle.ґcsound-expressionмThe sequence of inversed ramp functions. The first argument is a duty cycle.ўcsound-expression!The sequence of triangular waves.╞csound-expression(The sequence of ramped triangular waves.╟csound-expressionThe sequence of ADSR-envelopes.seqAdsr att dec sus rel It has to be:att + dec + sus_time + rel == 1╠csound-expression+The sequence of exponential ADSR-envelopes.╡csound-expression4The sequence of ADSR-envelopes with rest at the end.seqAdsr att dec sus rel rest It has to be:&att + dec + sus_time + rel + rest == 1Ёcsound-expressionюThe sequence of exponential ADSR-envelopes with rest at the end.Єcsound-expressionЛFunction for creation of accented beats. The steady beat pattern of accents is repeated. The first argument describes the list of integers. Each integer is a main beat and the length of the beat. We can create a typical latino beat:-dac $ mul (seqSaw [seqPat [3, 3, 2]] 1) white╣csound-expression It's like seqPatк but inplace of rests it fills the gaps with segments descending in value..dac $ mul (seqSaw [seqDesc [3, 3, 2]] 1) whiteІcsound-expression It's like seqPatй but inplace of rests it fills the gaps with segments ascending in value.-dac $ mul (seqSaw [seqAsc [3, 3, 2]] 1) whiteЇcsound-expression It's like seqPat2 but inplace of rests it fills the gaps with 0.5s..dac $ mul (seqSaw [seqHalf [3, 3, 2]] 1) white╦csound-expression Alias for humanVal.╧csound-expression Alias for humanTime.╨csound-expression Alias for humanValTime.╩csound-expressionАTriggers the table based envelope when the trigger signal equals to 1 and plays for dur seconds:trigTab table dur trigger╪csound-expressionЛTriggers the table based envelope when the something happens on the event stream and plays for dur seconds:trigTabEvt table dur triggerэЦБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪эЛМЦ╩╪НПЯТОРСУЖВЭЗШЩЬЫХИЙЕФГБЦД╦╧╨▒▓⌠■∙√⌡°²─│ЪЧ┌┐└┘┤┬┴├┼▀▄█▐▌░≈≤≥ К·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄІ╣Ї%None >?юабив╦╞┬нопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярсту┬вьытужярснопзшэщНОПЯЖВЬЫЧЪ─│├┤┬┴▌▐░▒√≈≤≥·÷═║ії╗╘РСТУЗШЭЩ┌┐└┘┼▀▄█▓⌠■∙ ⌡°²╒ёє╔╙╚╛ґў╞╟╠ІЇ╦╧Ў©юафгхинопя╡ЁЄ╣╨╩╪ҐбцдейклмрстучъЮАФГХИБЦДЕЙКЛМ&None>юыЮуg>іcsound-expressionThe patch can be:a monophonic syntpolyphonic syntset of common parameters (SyntSkin)patch with chain of effects,(split on keyboard with certain frequency▀layer of patches. That is a several patches that sound at the same time. the layer is a patch and the weight of volume for a given patch.╟csound-expression)Specification for monophonic synthesizer. Chn -- midi channel to listen on-SlideTime -- time of transition between notesЄcsound-expressionStereo-output patch.╣csound-expressionMono-output patch.Іcsound-expressionлFx specification. It;s a pair of dryWet ratio and a transformation function.╨csound-expressionStereo effect.╩csound-expressionMono effect.Ґcsound-expression%An effect processes the input signal.Ўcsound-expression,An instrument transforms a note to a signal.©csound-expressionЯA simple csound note (good for playing with midi-keyboard). It's a pair of amplitude (0 to 1) and freuqncy (Hz).юcsound-expression%Data type for monophonic instruments.аcsound-expression-Generic monophonic instrument. It depends on SyntSkin.бcsound-expressionGeneric FX. It depends on SyntSkin.цcsound-expression-Generic polyphonic instrument. It depends on SyntSkin.дcsound-expression╧Common parameters for patches. We use this type to parametrize the patch with some tpyes of arguments that we'd like to be able to change after patch is already constructed. For instance the filter type can greatly change the character of the patch. So by making patches depend on filter type we can let the user to change the filter type and leave the algorithm the same. It's like changing between trademarks. Moog sound vs Korg sound.-The instruments in the patches depend on the SyntSkin through the Reader data type.?If user doesn't supply any syntSkin value the default is used (н⌡ -- moog low pass filter). Right now the data type is just a synonym for filter but it can become a data type with more parameters in the future releases.еcsound-expressionтConstructor for polyphonic synthesizer. It expects a function from notes to signals.фcsound-expressionгConstructor for polyphonic synthesizer with flexible choice of the low-pass filter. If we use the filter from the first argument user lately can change it to some another filter. It defaults to mlp.гcsound-expressionФConstructor for monophonic synth with envelope generator. The envelope generator is synced with note triggering. So it restarts itself when the note is retriggered. The envelope generator is a simple ADSR gennerator see the type MonoAdsr.хcsound-expressionГConstructor for monophonic synth with envelope generator and flexible choice of filter. It's just like adsrMonoч but the user lately can change filter provided in the first argument to some another filter.иcsound-expressionЕConstructor for monophonic synthesizer. The instrument is defned on the raw monophonic aruments (see MonoArg).йcsound-expressionцConstructor for monophonic synthesizer with flexible filter choice.кcsound-expression!Constructor for FX-specification.fxSpec dryWetRatio fxFunлcsound-expression=Constructor for FX-specification with flexible filter choice.fxSpec dryWetRatio fxFunоcsound-expression#Removes all effects from the patch.пcsound-expression7Sets the dryWet ratio of the effects wwithin the patch.яcsound-expressionфSets the dryWet ratios for the chain of the effects wwithin the patch.рcsound-expression.Renders the effect chain to a single function.сcsound-expression*Plays a patch with a single infinite note.тcsound-expressionPlays a patch with midi.уcsound-expression4Plays a patch with midi with given temperament (see Csound.Tuning).жcsound-expression Plays a patch with event stream.вcsound-expressionMetronome with a chain of accents. A typical 7/8 for example: dac $ nticks [3, 2, 2] (135 * 2)║csound-expression Metronome.ticks n bpm╘csound-expressionяWave shaper. The signal should be bipolar. It ranges within the interval [-1, 1].wshaper table amount asigеwave shaper transforms the input signal with the table. The amount of transformation scales the signal from 0 to 1. the amount is ratio of scaling. It expects the values from the interval [0, 1].╙csound-expressionWave shaper with sigmoid.&genSaturator sigmoidRadius amount asigsigmoid radius is 5 to 100.amount is [0, 1]╚csound-expression Alias forgenSaturator 5╛csound-expression Alias forgenSaturator 10ґcsound-expression Alias forgenSaturator 50ўcsound-expression Alias forgenSaturator 100╞csound-expressionеDetects attacks in the signal. Outputs event stream of attack events.attackTrig threshold sigInчthreshhold cnmtrols the sensitivity of attack detection. Try out different values in [0, 0.2]╟csound-expressionФDetects attacks in the signal. Outputs trigger-signal where 1 is when attack happens and 0 otherwise.╠csound-expression╛Make smooth attacks for the input guitar or piano-like sounds. It simulates automatic volume control pedal. It detects striken attacks and makes them sound more PAD-like.Вfirst argument is threshold that controls sensitivity of attack detection. The values like ~ 0.01, 0.02 is good start.ГTo use it with guitar it's good to add a bit of distortion and compression to the signal to make it brighter and then to apply several delays to prolong the sustain and release phases. And it's good to add some reverb at the end.бHere is an example of how to make ambient guitar with this effect:чmain = dac proc -- | Let's assume we read guitar from the first input of sound card proc :: Sig2 -> SE Sig2 proc (x, _) = mul 1 $ hall 0.25 $ fmap ( fromMono . (adele 0.35 1 0.65 0.34) . (adele 0.35 0.25 0.75 0.34) . saturator 0.3 . tort 0.1 0.25 . magnus 2 0.25 1.1 0.6 0.4 1.8) $ ambiEnv 0.02 x ╦So I've added a tape echo with magnus, then goes combo of saturator (compressor) and tort (distortion) then goes a couple of delays (adele) and the last part is sweet reverb (hall).0Д┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠0┬┴┼▀▄█▐▌┘├┤░┐└▓▒■⌠√∙≈≤≥°Д╘╙╛╚ґў ⌡║²╒·ё÷є═╔ії╗╞╟╠'None?ыЩбЁcsound-expressionшExternal controllers. We can control the looper with UI-widgets but sometimes it's convenient to control the loper with some external midi-device. This structure mocks all controls (except knobs for effects and mix).loopTapр - selects the current tap. It's a stream of integers (from 0 to a given integer).loopFadeЪ - can fade in or fade out a group of taps. It's a list of toggle-like event streams. they produce 1s for on and 0s for off.loopDel█ - is for deleting the content of a given tap. It's just a click of the button. So the value should be an event stream of units (which is Tick = Evt Unit).loopThrough! - is an event stream of toggles.All values are wrapped in the Maybe type. If the value is Nothingф in the given cell the looper is controled only with virtual widgets.There is an instance of Default for LoopControl with all values set to NothingД. It's useful when we want to control only a part of parameters externally. We can use the value def to set the rest parameters:def { loopTap = Just someEvt }╧csound-expressionюThe type for fine tuning of the looper. Let's review the values: loopMixValф - list of initial values for mix levels (default is 0.5 for all taps) loopPrefx> - list of pre-loop effects (the default is do-nothing effect) loopPostfx? - list of post-loop effects (the default is do-nothing effect)loopPrefxValя - list of dry/wet values for pre-looop effects (the default is 0.5 for all taps) loopPostfxValр - list of dry/wet values for post-looop effects (the default is 0.5 for all taps) loopInitInstrХ - the initial sounding tap (sound source) (what tap we are going to record when the looper starts up). loopFadesъ - the list of instrument groups to fade/out. Eachl list item is a list of integers where an integer points to a tap number. By default a single fader is given to each tap. with lists of integers we can group the sound sources by their functions in the song. We may group all harmonic instruments in a single group and all drums into another group.loopReeatFadesъ -- a repeat fade weight is a value that represents an amount of repetition. A looping tap is implemented as a delay tap with big feedback. The repeat fades equals to the feedback amount. It have to be not bigger than 1. If the value equals to 1 than the loop is repeated forever. If it's lower than 1 the loop is gradually going to fade.loopControlс -- specifies an external controllers for the looper. See the docs for the type LoopSpec.дcsound-expressionThe midiLoop╣ that is adapted for usage with soundfonts. It takes in a list of pairs of sound fonts as sound sources. The second value in the pair is the release time for the given sound font.еcsound-expressionThe sigLoop├ that is adapted for usage with midi instruments. It takes a list of midi instruments in place of signal inputs. The rest is the sameфcsound-expressionЪSimple multitap Looper. We can create as many taps as we like also we can create fade outs/ins insert effects and control mix.sigLoop spec bpm times imputs Arguments:looper spec (see the docs for the type)main bpm. rate. All taps are aligned with the main rateыlist of multipliers for each tap. Each tap is going to have a fixed length that is a multiplier of the main rate. It doesn't have to be an integer. So we can create weird drum patterns with odd loop durations.Бlist of signal sources. By convention all sources are stereo signals. We can use the function fromMono& to convert the mono signal to stereo.ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдеф╧╨╩╪ҐЎ©юабцЁЄ╣ІЇ╦фед(None >?юивы(2кcsound-expressionClip size in barsлcsound-expression"Clip offset from beginning in barsмcsound-expression%Clip skip time at the end of the clipнcsound-expressionпNext clip to play after this one is finished. If it's -1 then play the same clipоcsound-expressionкShould we retrigger clip from the start or continue play where we left out.пcsound-expression"Volume scaling factor for the clipяcsound-expressionClip and it's parametersсcsound-expressionpath to the file of audio clipтcsound-expressionclip launch parametersЮcsound-expressionWidget that represents a mixer.Аcsound-expressionдWidget that represents a mixer with horizontal grouping of elements.Бcsound-expressionеTransforms the mono signal to the stereo input for the mixer widget.Цcsound-expressionйCreates a widget that represents a stereo signal processing function. The parameters of the widget are updated with sliders. For example let's create a simple gain widget. It can be encoded like this:⌠uiGain :: Double -> Source FxFun uiGain isOn gain = fxBox "Gain" fx isOn [("gain", gain)] where fx :: Sig -> Sig2 -> Sig2 fx = mul+Let's look at the arguments of the functionfxBox name fx isOn argsname -- is the name of the widgetfx1 -- is signal processing function (see the class FxUI).isOn& -- whether widget in the active stateargsд -- list of initial values for arguments and names of the arguments..It's cool to set the color of the widget with fxColorх function. we can make our widgets much more intersting to look at. fxBox :: forall a. (FxUI a, Num (FxArg a), Tuple (FxArg a)) => String -> a -> Bool -> [(String, Double)] -> Source (Fx (FxArg a))Дcsound-expressionХCreates an FX-box from the given visual representation. It inserts a big On/Off button atop of the GUI.Еcsound-expressionColors the source widgets.Фcsound-expression-Scales the gui for signal processing widgets.Гcsound-expressionИGroups the signal processing widgets. The functions are composed the visuals are grouped horizontally.Хcsound-expressionГGroups the signal processing widgets. The functions are composed the visuals are grouped vertically.Иcsound-expressionCreates a matrix of fx-boxes.fxGrid columnsSize fxs2first argument is a number of columns in each row.Йcsound-expressionfxHorД for chain that starts with mono effects and proceeds with stereo effects. The second argument can contain The transition widget (mono to stereo effect) or it can be empty. If it's empty automatic conversion will be inserted.Кcsound-expressionfxVerД for chain that starts with mono effects and proceeds with stereo effects. The second argument can contain The transition widget (mono to stereo effect) or it can be empty. If it's empty automatic conversion will be inserted.Лcsound-expressionцCreates a matrix of fx-boxes. Stacks a list of mono and stereo FXs.0fxGrid columnsSize monoFxs maybeBridge stereoFxs2first argument is a number of columns in each row.Мcsound-expression)Applies FX with UI to the input argument.Нcsound-expression3Applies a function to a signal processing function.Оcsound-expressionApplies FX to the Patch.Пcsound-expression(The distortion widget. The arguments are+uiDistort isOn levelOfDistortion drive toneЯcsound-expression$The chorus widget. The arguments are"uiChorus isOn mix rate depth widthСcsound-expression%The flanger widget. The arguments are)uiFlanger isOn rate depth delay feedbackТcsound-expression$The phaser widget. The arguments are/uiPhaser isOn mix feedback rate depth frequencyУcsound-expression#The delay widget. The arguments are(uiDelay isOn mix feedback delayTime toneЖcsound-expression.The simplified delay widget. The arguments are+uiEcho isOn maxDelayTime delayTime feedbackВcsound-expression%The pair of low and high pass filters5uiFilter isOn lowPassfrequency highPassFrequency gainЬcsound-expression%The reverb widget. The arguments are:uiReverb mix depthЫcsound-expression=The gain widget, it's set to on by default. The arguments areuiGain amountOfGainЗcsound-expression2The filtered white noize widget. The arguments are-uiWhite isOn centerFreqOfFilter amountOfNoizeШcsound-expression1The filtered pink noize widget. The arguments are,uiPink isOn centerFreqOfFilter amountOfNoizeЭcsound-expressionнThe constructor for signal processing functions with no arguments (controlls).Щcsound-expression#Midi chooser implemented as FX-box.Чcsound-expression0the widget for mixing in a signal to the signal.Ъcsound-expressionыA mixer widget represented as an effect. The effect sums the signals with given wieghts.┌csound-expression⌠A widget with four standard waveforms: pure tone, triangle, square and sawtooth. The last parameter is a default waveform (it's set at init time).┐csound-expressionSlider for master volume└csound-expressionKnob for master volume┘csound-expressionбChooses a midi instrument among several alternatives. It uses the hradio for GUI groupping.├csound-expressionбChooses a midi instrument among several alternatives. It uses the vradio for GUI groupping.┤csound-expression>Chooses an instrument among several alternatives. It uses the hradio for GUI groupping.┬csound-expression>Chooses an instrument among several alternatives. It uses the vradio for GUI groupping.┴csound-expression Compressor2uiCompress thresh loknee hiknee ratio att rel gain▀csound-expression&Live row triggers audio clips in sync.#liveRow clips bpm barSize clipIndexclips$ - contains file path to audio clipsbpm - the BPM of the track barLength4 - length of the bar in quater notes. So 4 means 4/4 clipIndex2 - identity of the clip to launch on the next bar.▄csound-expressionStereo version of liveRowфийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌фЮАБЦДЕХГИФНМОЙКЛ┼┤┬┘├ПЯСТУЖВЬЫ┴ЗШЭРЧЪЩшэщчъужвьыз─│┌┐└ярстийклмноп▀▄█▌)None?Ю+х▒csound-expressionКAnalog Delay line with low-pass filter in the feedback chain. The filter adds natural decay to the echoes./adele mixRatio delayTime feedback toneRatio ainэNote that the center frequency of the filter is measured in normalized units (form 0 to 1).▓csound-expression%Distortion unit with low-pass filter.tort driveLevel toneRatio ainэNote that the center frequency of the filter is measured in normalized units (form 0 to 1).⌠csound-expressionEnvelope follower.3fowler sensitivity baseFrequencyRatio resonance ain Arguments:sensitivity ц -- sensitivity of the envelope follower (suggested range: 0 to 1)baseFrequencyRatio ы -- base frequency of the filter before modulation by the input dynamics (range: 0 to 1)resonance > -- resonance of the lowpass filter (suggested range: 0 to 1)■csound-expression1An effect that reverses an audio stream in chunks revsy timetime& -- the size of the chunck in seconds.∙csound-expressionхA flanger effect following the typical design of a so called 'stomp box') flan rate depth delayTime feedback ain = Arguments rate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1) depth 2 -- depth of the lfo of the effect (range 0 to 1) delayTime > -- static delay offset of the flanging effect (range 0 to 1) feedback б -- feedback and therefore intensity of the effect (range 0 to 1) ain = -- input audio to which the flanging effect will be applied√csound-expressionPhaserйAn phase shifting effect that mimics the design of a so called 'stomp box'phasy rate depth freq fback ain Arguments:rate - -- rate of lfo of the effect (range 0 to 1)depth . -- depth of lfo of the effect (range 0 to 1)freq ж -- centre frequency of the phase shifting effect in octaves (suggested range 0 to 1)fback б -- feedback and therefore intensity of the effect (range 0 to 1)ain $ -- input audio to be pitch shifted≈csound-expressionLoFi (Bit Crusher)н'Low Fidelity' distorting effects of bit reduction and downsampling (foldover)crusher bits fold ain = ... Argumentsbits ' -- bit depth reduction (range 0 to 1)fold & -- amount of foldover (range 0 to 1)ain ю -- input audio to have low fidelity distortion effects applied≤csound-expression Stereo ChorusA stereo chorus effect*chory rate depth width (ainLeft, ainRight) Argumentsrate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1)depth 2 -- depth of the lfo of the effect (range 0 to 1)width , -- width of stereo widening (range 0 to 1)ainX -- input stereo signal≥csound-expressionAuto panpany wave rate depth ain; Arguments:wave : -- waveform used by the lfo (0=sine 1=triangle 2=square)rate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1)depth 2 -- depth of the lfo of the effect (range 0 to 1)ain -- input stereo audio csound-expression Sine auto panoscPany = pany 0⌡csound-expressionTriangle auto pantriPany = pany 1°csound-expressionSquare auto pansqrPany = pany 2²csound-expressionTremolotremolo effecttremy wave rate depth ain; Arguments:wave : -- waveform used by the lfo (0=sine 1=triangle 2=square)rate х -- rate control of the lfo of the effect *NOT IN HERTZ* (range 0 to 1)depth 2 -- depth of the lfo of the effect (range 0 to 1)ain -- input stereo audio·csound-expressionSine tremolooscTremy = tremy 0÷csound-expressionTriangle tremolotriTremy = tremy 1═csound-expressionSquare tremolosqrTremy = tremy 2║csound-expression RingModulator3An ring modulating effect with an envelope follower"ringo balance rate envelopeMod ainbalance ; -- dry / wet mix of the output signal (range 0 to 1) ; rate х -- frequency of thew ring modulator *NOT IN HERTZ* (range 0 to 1) ; envelopeMod я -- amount of dynamic envelope following modulation of frequency (range 0 to 1)ain % -- input audio to be pitch shifted╠csound-expression+magnus - simulates magnetic tape echo/delay3magnus size feedback echoGain tone randomSpread ain!size - how many heads in the tapefeedback echo gain:tone - normalized center frequency of the filter (0 to 1) SE Sig2 proc (x, _) = hall 0.25 $ ambiGuitar 0.02 1 0.7 0.4 0.1 xі░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ і▒╡▓⌠■∙√≈≤≥ ⌡°²·÷═║░╠╒ёє╔ії╗╘╙╚╛ґў╞╟ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭ└ ┐ ЩЧЪ─ │ ┌ ╣ *None;uІ csound-expressionPadsynth oscillator.padsynthOsc spec frequency█It makes it easy to create padsynth sound waves (see Tab.padsynth). It creates a padsynth table and reads it with poscil at the right speed.Ї csound-expressionьStereo padsynth oscillatro. It creates two padsynth ftables for left and right channels.╦ csound-expression└It uses several padsynth tables. Each table is responsible for specific interval of frequencies. The list of pairs specifies the threshhold value and padsynth specification. The padsynth table is active for all frequencies that lie below the given threshold.6padsynthOscMultiCps thresholdSpecPairs frequency = ...╧ csound-expressionStereo version of padsynthOscMultiCps.╨ csound-expressionIt behaves just like padsynthOscMultiCpsЩ but it spreads the padsynth tables among amplitude values. So the last input argument is a pair of amplitude and frequency:цpadsynthOscMultiVol thresholdSpecPairs (amplitude, frequency) = ...╩ csound-expressionStereo version of padsynthOscMultiVol.╪ csound-expressionTODO (undefined function)?With this function we can create square zones in the domain of (amplitude, frequency)У. We can assign a separate padsynth table for each zone. The list of pairs contains a pair of two threshold values (amplitude, frequency)& and dedicated padsynth specification.фpadsynthOscMultiVolCps thresholdSpecPairs (amplitude, frequency) = ...Ґ csound-expressionTODO (undefined function)Stereo version of padsynthOscMultiVolCps.Ў csound-expression1Creates padsynth oscillator with given harmonics.%bwOscBy harmonics bandwidth frequency© csound-expressionStereo version of bwOscBy.ю csound-expression5Creates padsynth oscillator with given odd harmonics.(bwOddOscBy harmonics bandwidth frequencyа csound-expressionStereo version of bwOddOscBy.б csound-expression(Pure sine wave with padsynth wave table:bwOsc bandwidth frequencyц csound-expression'Triangle wave with padsynth wave table:bwTri bandwidth frequencyд csound-expression%Square wave with padsynth wave table:bwSqr bandwidth frequencyе csound-expression(Saw-tooth wave with padsynth wave table:bwSaw bandwidth frequencyф csound-expressionStereo version of bwOsc.г csound-expressionStereo version of bwTri.х csound-expressionStereo version of bwSqr.и csound-expressionStereo version of bwSaw.й csound-expressionДCombines morpheus oscillators with padsynth algorithm. It uses single table for granular synthesis.к csound-expressionИCombines morpheus oscillators with padsynth algorithm. It uses up to four tables for granular synthesis.І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к І Ї Ў ю © а б ц д е ф г х и ╦ ╧ ╨ ╩ ╪ Ґ й к 2None;Й≥▀▌╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц И Д Е Ф Х Г °²·╒║═÷ё╚╛╦╧ЎҐ╨╪╩ЦДВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈цдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАЕДБЦФГХИЙКЛМНОПЯРСТУ─ЪЧЩЭШЗЫЬЖВ│┌┐└┘├┤┬┴┼√≈≤≥ ⌡°²·÷═║╒ёє╔ії╙╗╘╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПёє╔ії╚╙╗╘╛І╣ЄЁ╟╞ўґ╠╡Ї╨╧╦╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЧЪ─│┌┐└▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцкйихгфделмяпнорсжтувьызшэФЕДЦБАЮъщчГЙХИКЛОМНПЯ┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТРС▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎгхийклпомнярустжвьызшэщчБЦДЦЕФГФХИЙИКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪нопоярсртужувьыьзшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстуі╛╚╙╘ї╗ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩ┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠ЁЄ╦Ї╣І╧╨цбаю©ЎҐ╩╪дефийпонмклярстужзывьшэъщчЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к NoneH:╘о н п л м я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─!│!┌!┐!└!┘!├!┤!'& !"#%$0/()*+,.-321<456789;:?>=U@ABCDEFGHIJKLMNOPQRTS]\VWXY[Zgabcdfe^`_lkhjisrmnoqp}|tuvwxy{z├~─│┌┐┘└∙■┤┬┴┼▀▄█▌▐░▒⌠▓≥√≤≈їі ⌡°²·÷═║╒ё╔є╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ ї і ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц И Д Е Ф Х Г Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·╒║═÷ё╚╛╦╧ЎҐ╨╪╩©юабцдефгхийклмнопярсжутвьзшАЮэщъчБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юбацдефгхийклнмпорятсжвжуыьзшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ є ╒ ║ ё ╔ і ї ╙ ╘ ╗ Й ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г И Х К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄▐▌█⌠▓▒░≈√∙■ ≥≤⌡╒°²÷═·║їёєі╔╛╗╘╚╙╟ґ╞ўЄ╠Ё╡ЇІ╣к╦╧╨╩╪ҐЎ©юабцдефгхйитлмнопясрыужьвзЙшэщчъЮАБЦДЕФГИХцбЎ©аюдефгхийклмнопярстужвьызшэщчъЙИЮАБЦДЕФХГКЛМ┬!┴!┼!▀!▄!█!▌!▐!░!▒!▓!⌠!Н■!∙!√!≈!≤!О≥! !⌡!°!²!·!÷!═!║!╒!ё!ТСПРЯє!╔!і!ї!╗!╘!У╙!╚!╛!ґ!ў!╞!╟!╠!╡!Ё!Є!Ж╣!І!Ї!╦!╧!╨!ВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·²÷═║╒║ёє╔єії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔і╘ї╗╙╚╡╠╟ўґ╞╛ЁЄ╣ІЇ╪╩╨╦╧ҐюЎ©абцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАЕДБЦФГХИЙКЛМНОПЯРСТУ─ЪЧЩЭШЗЫЬЖВ│┌┐└┘├┤┬┴┼√≈≤≥ ⌡°²·÷═║╒ёє╔ії╙╗╘╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²ёє╔іїі╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦФДЕГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓ёє╔ії╚╙╗╘╛І╣ЄЁ╟╞ўґ╠╡Ї╨╧╦╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЧЪ─│┌┐└▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцкйихгфделмяпнорсжтувьызшэФЕДЦБАЮъщчГЙХИКЛОМНПЯ┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТРС▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎгхийклпомнярустжвьызшэщчБЦДЦЕФГФХИЙИКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪нопоярсртужувьыьзшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстуі╛╚╙╘ї╗ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩ┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠ЁЄ╦Ї╣І╧╨цбаю©ЎҐ╩╪дефийпонмклярстужзывьшэъщчЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к т ╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А ╩!EFGEFHEFIEFJEKLEKMEKNEKOEKPEKQEKREKSEKTEKTEUVEUWEUWEXYEFZEF[EF\EF]EF^EF_EF`EFaEFbEFcdefdegdehdeidejdekdeldemdendeodepdepdeqderdesdetdeudevdewdexdexdeydezde{de|de}de~dede─de│de┌de┐de└de┘de├de┤de┬de┴de┼de▀de▄de█de▌de▐de░de▒de▓de⌠de■de∙de√de≈de≤de≥de de⌡de°de²de·de÷de═de║de╒deёdeєdeєde╔deіdeїde╗de╘de╙de╚de╛deґdeўde╞de╟de╠de╡de╡deЁdeЄde╣deІdeЇde╦de╦de╧de╨de╩de╪deҐdeЎde©deюdeаdeаdeбdeцdeдdeеdeфdeгdeхdeиdeйdeкdeлdeмdeнdeоdeпdeяdeрdeсdeтdeуdeжdeвdeьdeьdeыdeзdeшdeэdeщdeчdeъdeЮdeАdeБdeЦdeДdeЕdeФdeГdeХdeИdeИЙКЛМНОМНПМНЯМНРМНСМНТМНУМНЖМНВМНЬМНЫМНЗМНШМНЭМНЩМЧЪМЧ─МЧ│МЧ┌МЧ┐МЧ└МЧ┘МЧ├МЧ┤МЧ┬МЧ┴МЧ┼МЧ▀МЧ▄МЧ█МЧ▌МЧ▐МЧ░МЧ▒МЧ▓МЧ⌠МЧ■МЧ∙МЧ√МЧ≈МЧ≤МЧ≥МЧ МЧ⌡МЧ°МЧ²МЧ·МЧ÷МЧ═МЧ║МЧ╒МЧёМЧєМЧ╔МЧіМЧїМЧ╗МЧ╘МЧ╙МЧ╚МЧ╛МЧґМЧўМ╞╟М╞╠М╞╡М╞ЁМ╞ЄМ╣ІМ╣ЇМ╣╦М╣╧М╣╨М╣╩М╣╪М╣ҐМ╣ЎМ╣©М╣юМ╣аМ╣бМ╣цМ╣дМ╣еМ╣фМ╣гМ╣хМ╣иМ╣йМ╣кМ╣лМ╣мМ╣нМ╣оМ╣пМ╣яМ╣рМ╣сМтуМтжМтвМтьМтыМтзМтшМтэМтщМтчМтъМтЮМтАМтБМтЦМтДМтЕМтФМтГМтХМтИМтЙМтКМтЛМтММтНМтОМтПМтЯМтРМтСМтТМтУМтЖМтВМтЬМтЫМтЗМтШМтЭМтЩМтЧМтЪМт─Мт│Мт┌Мт┐Мт└Мт┘Мт├Мт┤Мт┬Мт┴Мт┼Мт▀Мт▄Мт█Мт▌Мт▐Мт░Мт▒Мт▓Мт⌠Мт■Мт∙Мт√Мт≈Мт≤Мт≥Мт Мт⌡Мт°Мт²Мт·Мт÷Мт═Мт║Мт╒МтёМтєМт╔МтіМтїМт╗Мт╘Мт╙Мт╚Мт╛МтґМтўМт╞Мт╟Мт╠Мт╡МтЁМтЄМт╣МтІМтЇМт╦Мт╧Мт╨Мт╩М╪ҐМ╪ЎМ╪©М╪юМ╪аМ╪бМ╪цМ╪дМ╪еМ╪фМ╪гМ╪хМ╪иМ╪йМ╪кМ╪лМ╪мМ╪нМ╪оМ╪пМ╪яМ╪рМ╪сМ╪тМ╪уМ╪жМ╪вМ╪ьМ╪ыМ╪зМ╪шМ╪эМ╪щМ╪чМ╪ъМ╪ЮМ╪АМ╪БМ╪ЦМ╪ДМ╪ЕМ╪ФМ╪ГМ╪ХМ╪ИМ╪ЙМ╪КМ╪ЛМ╪ММ╪НМ╪ОМ╪ПМ╪ЯМ╪РМ╪СМ╪ТМ╪УМ╪ЖМ╪ВМ╪ЬМ╪ЫМ╪ЗМ╪ШМ╪ЭМ╪ЩМ╪ЧМ╪ЪМ╪─М╪│М╪┌М╪┐М╪└М╪┘М╪├М╪┤М╪┬М╪┴М╪┼М╪▀М╪▄М╪█М╪▌М╪▐М╪░М╪▒М╪▓М╪⌠М╪■М╪∙М╪√М╪≈М╪≤М╪≥М╪ М╪⌡М╪°М╪²М╪·М╪÷М╪═М╪║М╪╒М╪ёМ╪єМ╪╔М╪іМ╪їМ╪╗М╪╘М╪╙М╪╚М╪╛М╪ґМ╪ўМ╪╞М╪╟М╪╠М╪╡М╪ЁМ╪ЄМ╪╣М╪ІМ╪ЇМ╪╦М╪╧М╪╨М╪╩М╪╪М╪ҐМ╪ЎМ╪©М╪юМ╪аМ╪бМ╪цМ╪дМ╪еМ╪фМ╪гМ╪хМ╪иМ╪йМ╪кМ╪лМ╪мМ╪нМ╪оМ╪пМ╪яМ╪рМ╪сМ╪тМ╪уМ╪жМ╪вМ╪ьМ╪ыМ╪зМ╪шМ╪эМ╪щМ╪чМ╪ъМ╪ЮМ╪АМ╪БМ╪ЦМ╪ДМ╪ЕМ╪ФМ╪ГМ╪ХМ╪ИМ╪ЙМ╪КМ╪ЛМ╪ММ╪НМ╪ОМ╪ПМ╪ЯМ╪РМ╪СМ╪ТМ╪УМ╪ЖМ╪ВМ╪ЬМ╪ЫМ╪ЗМ╪ШМ╪ЭМ╪ЩМ╪ЧМ╪ЪМ─│М─┌М─┐М─└М─┘М─├М─┤М─┬М─┴М─┼М─▀М─▄М─█М─▌М─▐М─░М─▒М─▓М─⌠М─■М─∙М─√М─≈М─≤М─≥М─ М─⌡М─°М─²М─·М─÷М─═М─║М─╒М─ёМ─єМ─╔М─іМ─їМ─╗М─╘М─╙М─╚М─╛М─ґМ─ўМ─╞М─╟М─╠М─╡М─ЁМ─ЄМ─╣М─ІМ─ЇМ─╦М─╧М─╨М─╩М─╪М─ҐМ─ЎМ─©М─юМ─аМ─бМ─цМ─дМ─еМ─фМ─гМ─хМ─иМ─йМ─кМ─лМ─мМ─нМ─оМ─пМ─яМ─рМ─сМ─тМ─уМ─жМ─вМ─ьМ─ыМ─зМ─шМ─эМ─щМчъМчЮМчАМчБМчЦМчДМчЕМчФМчГМчХМчИМчЙМчКМчЛМчММчНМчОМчПМчЯМчРМчСМчТМчУМчЖМчВМчЬМчЫМчЗМчШМчЭМчЩМчЧМчЪМч─Мч│Мч┌Мч┐Мч└Мч┘Мч├Мч┤Мч┬Мч┴Мч┼Мч▀Мч▄Мч█Мч▌Мч▐Мч░Мч▒Мч▓Мч⌠Мч■Мч∙Мч√Мч≈Мч≤Мч≥Мч Мч⌡Мч°Мч²Мч·Мч÷Мч═Мч║Мч╒МчёМчєМч╔МчіМчїМч╗Мч╘Мч╙Мч╚Мч╛МчґМчўМч╞Мч╟Мч╠Мч╡МчЁМчЄМч╣МчІМчЇМч╦Мч╧Мч╨Мч╩Мч╪МчҐМчЎМч©МчюМчаМчбМчцМчдМчеМчфМчгМчхМчиМчйМчкМчлМчмМчнМчоМчпМчяМчрМчсМчтМчуМчжМчвМчьМчыМчзМчшМчэМчщМччМчъМчЮМчАМчБМчЦМчДМчЕМчФМчГМчХМчИМчЙМчКМчЛМчММчНМчОМчПМчЯМчРМчСМчТМчУМчЖМчВМчЬМчЫМчЗМчШМчЭМчЩМчЧМчЪМч─Мч│Мч┌Мч┐Мч└МчDМч┘Мч├Мч┤Мч┬Мч┴Мч┼Мч▀Мч▄Мч█Мч▌Мч▐Мч░Мч▒Мч▓МчBМч⌠Мч■Мч∙Мч√Мч≈Мч≤МчCМч≥Мч Мч⌡Мч°Мч²Мч·Мч÷Мч═Мч║Мч╒МчёМчєМч╔МчіМчїМч╗Мч╘Мч╙Мч╚Мч╛МчґМчўМч╞Мч╟Мч╠Мч╡МчЁМчЄМч╣МчІМчЇМч╦Мч╧Мч╨Мч╩Мч╪МчҐМчЎМч©МчюМчаМчбМчцМч/МчдМчеМчфМчгМчхМчиМчйМчкМчлМчмМчнМчоМчпМчяМчрМчсМчтМужМувМуьМуыМузМушМуэМущМучМуъМуЮМАБМАЦМАДМАЕМАФМАГМАХМИЙМИКМИЛМИММНОМНПМНЯМНРМНСМНТМНУМНЖМНВМНЬМНЫМНЗМНШМНЭМНЩМНЧМНЪМН─МН│МН┌МН┐МН└МН┘МН├МН┤МН┬МН┴МН┼МН▀МН▄МН█МН▌МН▐МН░МН▒МН▓МН⌠МН■МН∙МН√МН≈МН≤МН≥МН МН⌡МН°МН²МН·МН÷МН═МН║МН╒МНёМНєМН╔МНіМНїМН╗МН╘МН╙МН╚МН╛МНґМНўМН╞МН╟М╠╡М╠ЁМ╠ЄМ╠╣М╠ІМ╠ЇМ╠╦М╠╧М╠╨М╠╩М╠╪М╠ҐМ╠ЎМ╠©М╠юМ╠аМбцМбдМбеМбфМбгМбхМбиМбйМбкМблМбмМбнМбоМбпМбяМбрМбсМбтМбуМбжМвьМызМышМыэМыщМычМыъМыЮМАБМАЦМАДМАЕМАФМАГМХИМХЙМХКМХЛМХММХНМХОМХПМХЯМХРМСТМСУМСЖМСВМСЬМСЫМСЗМСШМСЭМСЩМСЧМСЪМС─ МС│ МС┌ МС┐ М└ ┘ М└ ├ М└ ┤ М└ ┬ М└ ┴ М└ ┼ М└ ▀ М└ ▄ М└ █ М└ ▌ М└ ▐ М░ ▒ М░ ▓ М░ ⌠ М░ ■ М░ ∙ М░ √ М░ ≈ М░ ≤ М░ ≥ М░ М░ ⌡ М░ ° М░ ² М░ · М░ ÷ М░ ═ М░ ║ М░ ╒ М░ ё М░ є М░ ╔ М░ і М░ ї М░ :М░ ╗ М░ ╘ М░ ╙ М░ ╚ М░ ╛ М░ ґ М░ ў М░ ╞ М░ ╟ М░ ╠ М░ ╡ М░ Ё М░ Є М░ ╣ М░ І М░ Ї М░ ╦ М░ ╧ М░ ╨ М░ ╩ М░ ╪ М░ Ґ М░ Ў М░ © М░ ю М░ а М░ б М░ ц М░ д М░ е М░ ф М░ 9М░ г М░ х М░ и М░ й М░ к М░ л М░ м М░ н М░ о М░ п М░ я М░ р М░ с М░ т М░ у М░ ж М░ в М░ ь М░ ы М░ з М░ ш М░ э М░ щ М░ ч М░ ъ М░ Ю М░ А М░ Б МЦ Д МЦ Е МЦ Ф МЦ Г МЦ Х МЦ И МЦ Й МК Л ММ Н ММ О ММ П ММ Я ММ Р ММ С ММ Т ММ У ММ Ж ММ В ММ Ь ММ Ы ММ З ММ Ш ММ Э ММ Щ ММ Ч ММ Ъ ММ ─ ММ │ ММ ┌ ММ ┐ ММ └ ММ ┘ ММ ├ ММ ┤ ММ ┬ ММ ┴ ММ ┼ ММ ▀ ММ ▄ ММ █ ММ ▌ ММ ▐ ММ ░ ММ ▒ ММ ▓ ММ ⌠ ММ ■ ММ ∙ ММ √ ММ ≈ ММ ≤ ММ ≥ ММ ММ ⌡ ММ ° ММ ² ММ · ММ ÷ ММ ═ ММ ║ ММ ╒ ММ ё ММ є ММ ╔ ММ і ММ ї ММ ╗ ММ ╘ ММ ╙ ММ ╚ ММ ╛ ММ ґ ММ ў М╞ ╟ М╞ ╠ М╞ ╡ М╞ Ё М╞ Є М╞ ╣ М╞ І М╞ Ї М╞ ╦ М╞ ╧ Й╨ ╩ Й╪ Ґ ЙЎ © ЙЎ ю ЙЎ а ЙЎ б Йц д Йц е Йц ф Йц г Йц х Йц и Йц й Йц к Йц л Йц м Йц н Йо п Йо я Йо р Йо с Йо т Йо у Йж в Йж ь Йж ы Йж з Йж ш Йж э Йж щ Йж ч Йж ъ ЙЮ А ЙЮ Б ЙЮ Ц ЙЮ Д ЙЮ 6ЙЮ 5ЙЕ Ф ЙЕ Г ЙЕ Х ЙЕ И ЙЕ Й ЙЕ К ЙЕ Л ЙЕ М ЙЕ Н ЙЕ О ЙП Я ЙП Р ЙП С ЙП Т ЙП У ЙП Ж ЙП В ЙП Ь ЙЫ З ЙЫ Ш ЙЫ Э ЙЫ Щ ЙЫ Ч ЙЫ Ъ ЙЫ ─ЙЫ │ЙЫ ┌Й┐└Й┐┘Й┐├Й┤┬Й┤┬Й┴┼Й┴▀Й┴▄Й┴█Й┴▌Й┴▐Й┴░Й┴▒Й┴▓Й┴⌠Й┴■Й┴∙Й┴√Й┴≈Й┴≤Й┴≥Й┴ Й┴⌡Й┴°Й┴²Й┴·Й┴÷Й┴═Й┴║Й┴╒Й┴ёЙ┴єЙ┴╔Й┴іЙ┴їЙ┴╗Й┴╘Й┴╙Й┴╚Й┴╛Й┴ґЙ┴ўЙ┴╞Й┴╟Й┴╠Й┴╡Й┴ЁЙ┴ЄЙ┴╣Й┴ІЙ┴ЇЙ┴╦Й┴╧Й┴╨Й┴╩Й┴╪Й┴ҐЙ┴ЎЙ┴©Й┴юЙ┴аЙ┴бЙ┴цЙ┴дЙ┴еЙ┴фЙ┴гЙ┴хЙ┴иЙ┴йЙ┴кЙлмЙлнЙлоЙлпЙляЙлрЙлсЙлтЙлуЙлжЙлвЙльЙлыЙлзЙлшЙлэЙлщЙлчЙлъЙлЮЙлАЙлБЙлЦЙлДЙлЕЙлФЙлГЙлХЙлИЙлЙЙлКЙлЛЙлМЙлНЙлОЙлПЙлЯЙлРЙлСЙлТЙлУЙлЖЙлВЙлЬЙлЫЙлЗЙлШЙлЭЙлЩЙлЧЙЪ─ЙЪ│ЙЪ┌ЙЪ┐ЙЪ└ЙЪ┘ЙЪ┘Й├┤Й┬┴Й┬┼Й┬▀Й▄█Й▄▌Й▄▐Й▄░Й▒▓Й▒⌠Й■∙Й■√Й■≈Й■≤Й■≥Й■ Й■⌡Й■°Й■²Й■·Й■÷Й═║Й═╒Й═ёЙ═єЙ═╔Й═іЙ═іЙї╗Йї╘Йї╙Йї╚Йї╛ЙїґЙїўЙї╞Й╟╠Й╟╡Й╟ЁЙ╟ЄЙ╟╣Й╟ІЙ╟ЇЙ╟;Й╟╦Й╟╧Й╟╨Й╟╩Й╟╪Й╟ҐЙ╟ЎЙ╟ЎЙ╟©Й╟юЙабЙцдЙцеЙцфЙцгЙцхЙциЙцйЙцйЙцкЙлмЙноЙпяЙпрЙпсЙптЙпуЙпжЙпвЙпьЙпыЙпзЙпшЙпэЙпщЙпчЙпъЙЮАЙЮБЙЮЦЙЮДЙЮЕЙЮФЙЮГЙЮХЙЮИЙЮЙЙЮКЙЮЛЙЮМЙЮНЙЮОЙЮПЙЮЯЙЮРЙЮСЙЮТЙЮУЙЮЖЙЮВЙЮЬЙЮЫЙЮЗЙЮШЙЮЭЙЮЩЙЮЧЙЮЪЙЮ─ ЙЮ│ ЙЮ┌ ЙЮ┐ ЙЮ└ ЙЮ┘ ЙЮ├ ЙЮ┤ ЙЮ┬ ЙЮ┴ ЙЮ┼ ЙЮ▀ ЙЮ▄ ЙЮ█ ЙЮ▌ ЙЮ▐ ЙЮ░ ЙЮ▒ ЙЮ▓ ЙЮ⌠ ЙЮ■ ЙЮ∙ ЙЮ√ ЙЮ≈ ЙЮ≤ ЙЮ≥ ЙЮ ЙЮ⌡ ЙЮ° ЙЮ² ЙЮ· ЙЮ÷ ЙЮ═ ЙЮ║ Й╒ ё Й╒ є Й╒ ╔ Й╒ і Й╒ ї Й╒ ╗ Й╒ ╘ Й╒ ╙ Й╒ ╚ Й╒ ╛ Й╒ ґ Й╒ ў Й╒ ╞ Й╒ ╟ Й╒ ╠ Й╒ ╡ ЙКЁ ЙКЄ ЙК╣ ЙКІ ЙКЇ ЙК╦ ЙК╧ ЙК╨ ЙК╩ ЙК╪ ЙКҐ ЙКЎ ЙК© ЙКю ЙКа ЙКб ЙКц ЙКд ЙКе ЙКф ЙКг Йх и Йх й Йх к Йх л Йх м Йх н Йх о Йх п Йх я Йх р Йх с Йх т Йх у Йх ж Йх в Йх ь Йх ы Йх з Йх ш Йх э Йх щ Йх ч Йх ъ Йх Ю Йх А Йх Б Йх Ц Йх Д Йх Е Йх Ф Йх Г Йх Х Йх И Йх Й Йх К Йх Л Йх М Йх Н Йх О Йх П Йх Я Йх Р Йх С Йх Т Йх У Йх Ж Йх В Йх Ь Йх Ы Йх З Йх Ш Йх Э Йх Щ Йх Ч Йх Ъ Йх ─Йх │Йх ┌Йх ┐Йх └Йх ┘Йх ├Йх ┤Йх ┬Йх ┴Йх ┼Йх ▀Йх ▄Йх █Йх ▌Йх ▐Йх ░Йх ▒Йх ▓Йх ⌠Йх ■Й∙√Й≈≤Й≈≥Й≈ Й≈⌡Й≈°Й≈²Й≈·Й≈÷Й≈═Й≈║Й≈╒Й≈ёЙ≈єЙ≈╔Й≈іЙ≈їЙ≈╗Й≈╘Й≈╙Й≈╚Й≈╛Й≈ґЙ≈ўЙ≈╞Й≈╟Й≈╠Й≈╡Й≈ЁЙ≈ЄЙ≈╣Й≈ІЙ≈ЇЙ≈╦Й≈╧Й≈╨Й≈╩Й≈╪Й≈ҐЙ≈ЎЙ≈©Й≈юЙ≈аЙ≈бЙ≈цЙ≈дЙ≈еЙ≈фЙ≈гЙ≈хЙ≈иЙ≈йЙ≈кЙ≈лЙ≈мЙ≈нЙ≈оЙ≈пЙ≈яЙ≈рЙ≈сЙ≈тЙ≈уЙ≈жЙ≈вЙ≈ьЙ≈ыЙ≈зЙ≈шЙэщЙэчЙэъЙэЮЙэАЙэБЙэЦЙэДЙэЕЙэФЙэГЙэХЙэИЙэЙЙэКЙэЛЙэМЙэНЙэОЙэПЙэЯЙэРЙэСЙэТЙэУЙэЖЙэВЙэЬЙЫЗЙЫШЙЫЭЙЫЩЙЫЧЙЫЪЙЫ─ЙЫ│ЙЫ┌ЙЫ┐ЙЫ└ЙЫ┘ЙЫ┘ЙЫ├ЙЫ┤ЙЫ┬ЙЫ┬ЙЫ┴ЙЫ┼ЙЫ▀ЙЫ▄ЙЫ█ЙЫ▌ЙЫ▐ЙЫ░ЙЫ▒ЙЫ▓ЙЫ⌠ЙЫ■ЙЫ∙ЙЫ√ЙЫ≈ЙЫ≤ЙЫ≥ЙЫ ЙЫ⌡ЙЫ°ЙЫ²ЙЫ·ЙЫ÷ЙЫ═ЙЫ║ЙЫ╒ЙЫёЙЫєЙЫ╔ЙЫіЙЫїЙЫ╗ЙЫ╘ЙЫ╙ЙЫ╚ЙЫ╛ЙЫґЙЫўЙЫ╞ЙЫ╟ЙЫ╠ЙЫ╡ЙЫЁЙЫЄЙЫ╣ЙЫІЙЫЇЙЫ╦ЙЫ╧ЙЫ╨ЙЫ╩ЙЫ╪ЙЫҐЙЫЎЙЫ©ЙЫюЙЫаЙЫбЙЫцЙЫдЙЫеЙЫфЙЫгЙЫхЙЫиЙЫйЙЫкЙЫлЙЫмЙЫнЙЫоЙЫпЙЫяЙЫрЙЫсЙЫтЙЫуЙЫжЙЫвЙЫьЙЫыЙЫзЙЫшЙэєЙэщЙэчЙэъЙэЮЙэАЙэБЙэЦЙэДЙэЕЙэФЙэГЙэХЙэИЙэЙЙэКЙэЛЙэМЙэНЙэОЙэПЙэЯЙэРЙэСЙэТЙэУЙэЖЙэВЙэ┤ЙэЬЙэЫЙэм ЙэЗЙэШЙэЭЙэЩЙэЧЙэЪЙэ─Йэ│Йэ┌Йэ┐Йэ└Йэ┘Йэ├Йэ┤Йэ┬Йэ┴Йэ┼Йэ▀Йэ▄Йэ█Йэ▌Йэ▐Йэ░Йэ▒Йэ▓Йэ⌠Йэ■Йэ∙Йэ√Йэ≈Йэ≤Йэ≥Йэ Йэ⌡Йэ°Йэ²Йэ·Йэ÷Йэ═Йэ║Йэ╒ЙэёЙэе ЙэєЙэ╔ЙээЙэіЙэїЙэ╗Йэ╘Йэ╙Й╚╛Й╚ґЙ╚ўЙ╚╞Й╚╟Й╚╟Й╠╡Й╠ЁЙ╠ЄЙ╠╣Й╠ІЙ╠ЇЙ╠╦Й╠╧Й╠╨Й╠╩Й╠╪Й╠ҐЙ╠ЎЙ╠©Й╠юЙ╠аЙ╠бЙ╠цЙ╠дЙ╠еЙ╠фЙ╠гЙ╠хЙ╠иЙ╠йЙ╠кЙ╠лЙ╠мЙ╠нЙ╠оЙ╠пЙ╠яЙ╠рЙ╠сЙ╠тЙ╠уЙ╠жЙ╠вЙ╠вЙ╠ьЙызЙшэщчъщчЮщчАщчБщчЦщчДщчДщЕФщЕГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴ ┼ ▀ ▄,█,▌,▐,░-▒-▓-⌠-■-∙-√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗ÷·²°⌡ ≤≥Ш√ЭЩ∙┼Ч▀▌█Ъ░▐─│┌┐└┘├┤┬┴┼▀▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟ ╠ ╡ Ё Є 3 ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ °²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╩╪ҐЎЎ©юабцдефгхийклмнопяярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМН║═÷ОПЯРСТУЖВЬЫЗШЭЩЧЪЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмноп я я р с с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь4Ы4З4Ш4Э4ЩЧЪ─│┌┐└8┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙Л√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийкклм=нопя>р?стужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийкл!м!н!о!п!я!р!с!т!у!ж!в!ь!ы!з!ш!э"щ"ч"ъ"Ю"А"Б"Ц"Д"Е"Ф"Г"Х"И"Й"К"Л"М"Н"О"П"Я"Р"С"Т"У"Ж"В"Ь"Ы"З"Ш"Э"Щ"Ч"Ъ"─"│"┌"┐"└"┘"├"┤"┬"┴"┼"▀▄█▌▐░#▒#▒#▓#⌠#■#∙#√#≈#≤#≥# # #⌡#°#²#·#÷#÷#═#║#╒#ё#ё#є#╔#і#і#ї#╗#╘#╙#╚#╛#ґ#ў#╞#╟#╠#╡#Ё#Є#╣#╣#І#Ї#╦#╧#╧#╨#╩#╪#Ґ#Ў#©#ю#а#б#ц#д#е#ф#г#х#и#й#к#л#м#н#о#п#я#р#с#т#у#ж#в#ь#ы#з#ш#э#щ#ч#ъ#Ю#А#Б#Ц#Д#Е#Ф#Г#Х#И#Й#К#Л#М#Н#О#П#Я#Р#С#Т#У#Ж#В#Ь#Ы#З#Ш#Э#Щ#Ч#Ъ#─#│#┌#┐#└#┘#├#┤#┬#┴#┼#▀#▄#█#▌$▐$▐$░$▒$▓$▓$⌠$■$∙$√$≈$≈$≤$≥$ $⌡$°$²$·$÷$═$║$╒$ё$є$╔$ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓%⌠%■%∙%√%≈%≤%≥% %⌡%°%²%·%÷%═%║%╒%ё%є%╔%і%ї%╗%╘%╙%╚%╛%ґ%ў%╞%╟%╠%╡%Ё%Є%╣%І%Ї%╦%╧%╨%╩%╪%Ґ%Ў%©%ю%а%б%ц%д%е%ф%г%х%и%й%к%л%м%н%о%п%я%р%с%т%у%ж%в%ь%ы%з%ш%э%щ%ч%ъ%Ю%А%Б%Ц%Д%Е%Ф%Г%Х%И%Й%К%Л%М%Н%О%П%Я%Р%С%Т%У%Ж%В%Ь%Ы%З%Ш%Э%Щ%Ч%Ъ%─%│%┌%┐%└%┘%├%┤%┬%┴%┼%▀%▄%█%▌%▐%░%▒%▓%⌠%■%∙%√%≈%≤%≥% %⌡%°%²%·%÷%═%║%╒%ё%є%╔%і%ї%╗%╘%╙%╚%╛%ґ%ў%╞%╟%╠%╡%Ё%Є%╣%І%Ї%╦%╧%╨%╩%╪%Ґ%Ў%©%ю%а%б%ц%д%е%ф%г%х%и%й%к%л%м%н%о%п%я%р%с%т%у%ж%в%ь%ы%з%ш%э%щ%ч%ъ%Ю%А%Б%Ц%Д%Е%Ф%Г%Х%И%Й&К&Л&М&Н&О&П&Я&Р&Р&С&Т&Т&У&Ж&В&Ь&Ы&Ы&З&Ш&Э&Щ&Ч&Ъ&─&│&┌&┐&└&┘&├&┤&┬&┴&┼&▀&▄&█&▌&▐&░&▒&▓&⌠&■&∙&√&≈&≤&≥& &⌡&°&²&·&÷&═&║&╒&ё&є&╔&і&ї&╗&╘&╙&╚&╛&ґ&ў&╞&╟&╠&╡&Ё&Є&╣&І&Ї&╦&╧&╨&╩&╪&Ґ&Ў&©&ю&а&б&ц&дефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТ'У'У'Ж'В'Ь'Ы'З'З'Ш'Э'Щ'Ч'Ъ'─'│'┌'┐'└'┘'├'┤'┬(┴(┴(┼(▀(▄(█(▌(▐(░(░(▒(▓(⌠(⌠(■(∙(√(≈(≤(≤(≥( (⌡(°(²(·(÷(═(║(╒(ё(є(╔(і(ї(╗(╘(╙(╚(╛(ґ(ў(╞(╟(╠(╡(Ё(Є(╣(І(Ї(╦(╧(╨(╩(╪(Ґ(Ў(©(ю(а(б(ц(д(е(ф(г(х(и(й(к)л)м)н)о)п)я)р)с)т)у)ж)в)ь)ы)з)ш)э)щ)ч)ъ)Ю)А)Б)Ц)Д)Е)Ф)Г)Х)И)Й)К)Л)М)Н)О)П)Я)Р)С)Т)У)Ж)В)Ь)Ы)З)Ш)Э)Щ)Ч)Ъ)─)│)┌)┐)└)┘)├)┤)┬)┴)┼)▀)▄)█)▌)▐)░)▒)▓)⌠)■)∙)√)≈)≤)≥) )⌡)°)²)·)÷)═)║)╒)ё)є)╔)і)ї)╗)╘)╙)╚)╛)ґ)ў)╞)╟)╠)╡)Ё)Є)╣)І)Ї)╦)╧)╨)╩)╪)Ґ)Ў)©)ю)а)б)ц)д)е)ф)г)х)и)й)к)л)м)н)о)п)я)р)с)т)у)ж)в)ь)ы)з)ш)э)щ)ч)ъ)Ю)А)Б)Ц)Д)Е)Ф)Г)Х)И)Й)К)Л)М)Н)О)П)Я)Р)С)Т)У)Ж)В)Ь)Ы)З)Ш)Э)Щ)Ч)Ъ)─ )│ )┌ )┐ )└ )┘ )├ )┤ )┬ )┴ )┼ )▀ )▄ )█ )▌ )▐ )░ )▒ )▓ )⌠ )■ )∙ )√ )≈ )≤ )≥ ) )⌡ )° )² )· )÷ )═ )║ )╒ )ё )є )╔ )і )ї )╗ )╘ )╙ )╚ )╛ )ґ )ў )╞ )╟ )╠ )╡ )Ё )Є )╣ )І )Ї )╦ )╧ )╨ )╩ )╪ )Ґ )Ў )© )ю )а )б )ц )д )е )ф )г )х )и )й )к )л )м )н )о )п )я )р )с )т )у )ж )в )ь )ы )з )ш )э )щ )ч )ъ )Ю )А )Б )Ц )Д )Е )Ф )Г )Х )И )Й )К )Л )М )Н )О )П )Я *Р *С *Т *У *Ж *В *Ь *Ы *З *Ш *Э *Щ *Ч *Ъ *─!*│!*┌!*┐!*└!*┘!*├!*┤!EF┬!EF┴!EF┼!EF▀!EF▄!█!▌!▐!█!▌!░!█!▌!▒!█!▌!▓!█!▌!⌠!█!▌!■!█!▌!∙!█!▌!√!█!▌!≈!█!▌!≤!█!▌!≥!█!▌! !█!▌!⌡!█!▌!°!█!▌!²!█!▌!·!█!▌!÷!█!▌!═!█!▌!║!█!▌!╒!█!▌!ё!█!▌!є!█!▌!╔!█!▌!і!█!▌!ї!E╗!╘!E╗!╘!E╗!╙!E╗!╚!E╗!╚!E╗!╛!E╗!ґ!E╗!ґ!E╗!ў!E╞!╟!E╞!╟!E╞!╠!E╞!╡!E╞!╡!E╞!Ё!E╞!Є!E╞!Є!E╞!╣!E╞!І!E╞!І!E╞!Ї!E╞!╦!E╞!╦!E╞!╧!E╞!╨!E╞!╨!E╞!╩!E╞!╪!E╞!╪!E╞!Ґ!Ў!©!ю!Ў!©!а!щчб!щчц!щчд!щче!щчф!щчг!щчх!щчи!щчй!щчк!щчл!щчм!щчн!щчо!щчп!щчя!щчр!щчс!щчт!щчу!щчж!щчв!щчь!щчы!щчз!щчш!щЕэ!щЕщ!щЕч!щЕъ!щЕЮ!щЕА!щЕБ!щЕЦ!щЕД!щЕЕ!щЕФ!щЕГ!щЕХ!щЕИ!щЕЙ!щЕК!щЕЛ!щЕМ!щЕН!щЕО!щЕП!щЕ┬щЕЯ!Р!.csound-expression-5.4.0-GENqi4AZGJMKGR1fxJxiTsCsound.BaseCsound.OptionsCsound.SigSpaceCsound.Air.WavCsound.Control.Midi Csound.IOCsound.Control.InstrCsound.TypesCsound.Control.OscCsound.Control.ChannelCsound.Control.SfCsound.Air.Wave.SyncCsound.Air.WaveCsound.Control.GuiCsound.Control.Gui.WidgetCsound.Air.Pan Csound.Air.FxCsound.Compat.FilterCsound.Control.EvtCsound.CabbageCsound.Air.EnvelopeCsound.Air.MiscCsound.Control.SE Csound.TabCsound.Control.Gui.PropsCsound.Control.Gui.LayoutCsound.Air.ScoCsound.Air.Filter Csound.Air.FmCsound.Air.SpecCsound.Air.Hvs Csound.TuningCsound.Air.SegCsound.Air.SamplerCsound.Air.GranularCsound.Air.Granular.MorpheusCsound.Air.ModArgCsound.Air.PatchCsound.Air.LooperCsound.Air.LiveCsound.Air.Fx.FxBoxCsound.Air.Padsynth Csound.CompatCsound.Control.Overload.Outs!Csound.Control.Overload.SpecInstrCsound.Opcode.Basicbuzz tabResolution CsdOptions Csound.AiroscBy!Csound.Control.Overload.MidiInstrmidimidinCsound.Control.OverloadmetrochangedtriggeraccumECsound.Render.Mix renderCsdplayCsddacCsound.Control Csound.OpcodelinsegexpseglinenbaseGHC.Base<*>pure*>ApplicativeControl.ApplicativeoptionalunwrapMonad WrapMonadWrappedMonadunwrapArrow WrapArrowWrappedArrow getZipListZipListData.Functor.ConstgetConstConstData.Functor<$>liftA3liftA<**><$liftA2manysome<|>emptyAlternative6csound-expression-dynamic-0.3.7-Fb2fHdMebwp1jFTYAE2dCUCsound.Dynamic.Types.Flags flagsVerbatimconfigdisplaysrtmidimidiRTmidiIO pulseAudiortaudioidTagsaudioFileOutputFlagsdithernopeaksnosoundinputoutput formatType formatSamplesAudioFileOutput RewriteHeaderNoHeaderFormatHeaderLongShortUlawFloatSamplesScharUcharAlawBit24 FormatSamplesUniform TriangularDitherXiWavexWavW64VocSvxSdsSd2RawPvfPafNisMat5Mat4IrcamHtkFlacCafAvrAuAiff FormatTypeidTitle idSoftwareidDateidCopyright idCommentidArtistIdTagsjackOutport jackInport jackClient NoRtaudio CoreAudioMmeJackAlsa PortAudioRtaudiopaInputpaOutputpaServer PulseAudioterminateOnMidirawControllerMode muteTracksmidiOutFilemidiFileMidiIO midiOutDevicemidiVelocityAmpmidiVelocity midiKeyPch midiKeyOct midiKeyCpsmidiKey midiDeviceMidiRTNoRtmidiVirtualMidi WinmmeMidiMmeMidiCoreMidiAlsaSeqAlsaMidiPortMidiRtmidilistOpcodesdisplayVerbosemsgColormBenchmarksmColoursmDb mWarningsmRangemAmpsmessageLeveldisplayHeartbeatdisplayModecsdLineNumsDisplaysAsciiDisplayPostScriptDisplay NoDisplayDisplayModesetTemposkipSecondsstrsetNschedNumsetSchedsmacroomacroscoreInnewSrnewKrioBufhwBufConfig4csound-expression-typed-0.2.5-4dg6xXikoaW6vEGny1fbrMCsound.Typed.Types.SigSpaceon8csound-expression-opcodes-0.0.5.1-8b7zpRzHpuF5znImgXumKj"Csound.Typed.Opcode.ZakPatchSystemzkwmzkwzkrzkmodzkclziwmziwzirzawmzawzargzarzamodzakinitzaclCsound.Typed.Opcode.Vectorialvcellacellvrandivrandhvportvecdelayvdelaykvwrapvmirrorvlimitvlinsegvexpsegvsubv_ivsubvvpowv_ivpowvvmultv_ivmultvvmapvexpv_ivexpvvdivv_ivdivvvcopy_ivcopyvaddv_ivaddvvpow_ivpowvmult_ivmultvexp_ivexpvadd_ivaddvtabwkvtabwivtabwavtablewkvtablewivtablewavtablekvtableivtableavtable1kvtabkvtabivtaba Csound.Typed.Opcode.TableControlsndload getftargsftgentmpftgenftfreeCsound.Typed.Opcode.Strings strupperkstrupperstrtolkstrtolstrtodkstrtod strlowerkstrlowerstrcharkstrcharstrsubkstrsub strrindexk strrindexstrlenkstrlen strindexkstrindexstrcpykstrcpystrcmpkstrcmpstrcatkstrcatsprintfksprintfputsstrsetstrget strfromurl&Csound.Typed.Opcode.SpectralProcessing temposcalpaulstretchmp3scalmincerfilescalcentroid lorisread lorisplay lorismorph atsSinnoi atsReadnzatsRead atsPartialtap atsInterpreadatsInfoatsCross atsBufreadatsAddnzatsAddtrsplittrshifttrscaletrmixtrlowest trhighesttrfiltertrcrosstradsyntabifdsinsynresynpvsynthpvswarppvsvocpvstrace pvstencilpvstanalpvspitchpvsoutpvsoscpvsmorphpvsmoothpvsmixpvsmaskapvslockpvsinitpvsinfopvsinpvsifdpvshiftpvsgain pvsfwritepvsftwpvsftr pvsfreezepvsfread pvsfilterpvsdisp pvsdiskinpvsdemixpvscrosspvscepspvscentpvscalepvsbufread2 pvsbufread pvsbufferpvsblurpvsbinpvsbandrpvsbandppvsarppvsanalpvsadsynpartials cudasynthcudaslidingcudanalbinitspectrumspecsumspecscalspecptrkspechistspecfiltspecdispspecdiffspecaddmlpslotlpresonlpreadlpinterplpfresonvpvoc tablexsegtablesegpvreadpvocpvinterppvcross pvbufreadpvadd ktableseg#Csound.Typed.Opcode.SignalModifiersminaccumminabsaccumminabsmin'maxaccummaxabsaccummaxabsmax_kmax'cmp powershapepdhalfypdhalfpdclip chebyshevpolywguide2wguide1zfilter2rbjeqpareqnlfilt2nlfilthilbert2hilbertfofilterfmanalfilter2eqfildcblock2dcblocktonektlinetosc_trigsc_lagudsc_lagresonxkresonkportkportlinetoatonekaresonkvlowrestbvcfsvfilterstatevarrezzyresonzresonyresonxresonrresonmvclpf4mvclpf3mvclpf2mvclpf1mvchpfmoogvcf2moogvcfmoogladder2 moogladderlpf18lowresxlowreslowpass2bqrezareson zdf_ladderzdf_2pole_mode zdf_2polezdf_1pole_mode zdf_1poletonextonemodemediankmediank35_lpfk35_hpfdopplerdiode_ladderclfiltbutterlpbutterhpbutterbrbutterbpbutlpbuthpbutbrbutbpbiquadabiquadatonexatonephaser2phaser1harmon4harmon3harmon2harmonflangerdistort1distortwrapmirrorlimitvasetvagetupsampsampholdntrpolinterpintegfolddownsampdiffdenormvcombvalpassreverbscreverb2reverbplaterevnreverbnestedapfreeverbcombinvcombbaboalpass vbapzmovevbapzvbapmove vbaplsinit vbapgmovevbapg vbap8movevbap8 vbap4movevbap4 vbap16movevbap16vbapspsendspdistspat3dtspat3dispat3dpan2panlocsiglocsendhrtfstat hrtfreverb hrtfmove2hrtfmove hrtfearly bformenc1bformenc bformdec1bformdec vdelayxws vdelayxwqvdelayxwvdelayxsvdelayxqvdelayxvdelay3vdelaymultitapdeltapxwdeltapxdeltapndeltapideltap3deltapdelaywdelayrvdel_kdelaykdelay1tvconv pconvolveliveconvftmorfftconvdconvcross2convolvegaindam compress2compressclipbalanceCsound.Typed.Opcode.SignalIOmp3len filevalidfilesrfilepeak filenchnlsfilelenfilebitprintsprintks2printksprintk2printkprintfprintf_iprint'flashtxtdispfftxoutxinsetksmpschnsetkschnset chnparamschnmixchngetkschnget chnexportchnclearchn_Schn_achn_kchanochani soundoutssoundoutoutzoutxoutvalueouts2outs1outsoutrgoutq4outq3outq2outq1outqoutoouthoutchoutcout32outmonitormdelaysoundinmp3ininzinxinvalueinsinrginqinoinhinchin32in'diskin2diskinreadk4readk3readk2readkreadfireadf hdf5writehdf5readfprintsfprintksfoutkfoutirfoutifoutfiopenfinkfinifinficlosedumpk4dumpk3dumpk2dumpk$Csound.Typed.Opcode.SignalGeneratorswgpluck2wgpluckwgflutewgclarwgbrass wgbowedbarwgbowstresonrepluckpluckwterraintableitable3tabletabwtabw_itabtab_iptableiptable3ptableoscil1ioscil1 stkWurley stkWhistlestkVoicFormstkTubeBellstkStifKarpstkSitar stkSimple stkShakersstkSaxofony stkRhodeystkResonate stkPluckedstkPercFlutstkMoogstkModalBarstkMandolinstkHevyMetlstkFlutestkFMVoices stkDrummerstkClarinetstkBrassstkBowedstkBlowHolestkBlowBotlstkBeeThreestkBandedWGxscanu xscansmapxscansxscanmapscanu scantablescans scanhammerwavesetsndloopsfpresetsfplistsfplaymsfplay3msfplay3sfplay sfpassignsfloopersfloadsfinstrm sfinstr3msfinstr3sfinstrsfilist lposcilsa2 lposcilsalposcilalposcil3lposcillphasorloscilxloscil3loscilfluidSetInterpMethodfluidProgramSelectfluidOut fluidNote fluidLoadfluidEnginefluidControlfluidCCkfluidCCifluidAllOutflooper2flooperbbcutsbbcutmweibullurandomunirandtrirandtrandomseedrsplinernd31randomirandomhrandomrandirandhrandpoissonpinkishpinkerpcauchynoiselinrandjsplinejitter2jittergetseed gausstriggaussigaussfractalnoiseexprandiexpranddust2cauchyicauchybexprndbetarand syncphasor sc_phasor phasorbnkphasorvoicevibes tambourinestixsleighbellsshakersekere sandpaperprepianoplanetmoogmarimbamandolmandellorenzguirogogobelgendyxgendycgendy dripwatercrunchchuapcabasabarmodelbambooxadsrmxadsrmadsrlinenrenvlpxrenvlpxadsrxyscaletransegrtransegbtransegscalelpsholdplooptsegloopsegplogcurvelinsegrlinsegblinlin gainsliderexpsegrexpsegbaexpsegbexpsegaexponexpcurvecossegrcossegbcossegbpfhvs3hvs2hvs1vosimsyncloop partikkelsyncpartikkelsetpartikkelgetgrain3grain2grainfogfof diskgrainfoscilifoscilfmwurliefmvoicefmrhodefmpercflfmmetalfmbellfmb3 crossfmpmi crossfmpmcrosspmicrosspmcrossfmicrossfmvco2initvco2iftvco2ftvco2vco squinewavempulsegbuzzvibratovibrposcil3posciloscilsosciln oscilikts osciliktposciliktoscilioscil3osciloscbnkhsbosciladsynt2adsyntadsyn*Csound.Typed.Opcode.SignalFlowGraphOpcodesoutletv outletkidoutletkoutletfoutletainletvinletkidinletkinletfinleta ftgenonceCsound.Typed.Opcode.SerialIO serialWrite_iserialWrite serialReadserialPrintserialFlush serialEndserialBegin!Csound.Typed.Opcode.RemoteOpcodesmidremot midglobalinsremot insglobal Csound.Typed.Opcode.RealtimeMIDImrtmsgmclockmidiprogramchangemidipolyaftertouch midipitchbend midinoteonpch midinoteonoct midinoteonkey midinoteoncpsmidinoteoffmididefaultmidicontrolchangemidichnmidichannelaftertouch noteondur2 noteondurnoteonnoteoffmoscilmidion2midionxtratimrelease midiout_imidioutmidiinpchmidibpchmidioctmidiboctmidicpstmidcpsmidibcpsmidiampmididampmidioutkpcoutkpboutkpatoutkc14outkcoutkatoutipcoutipboutipatoutic14outicoutiatnrpnvelocpolyaft pgmassignpchbendnotnummidictrlmidic7midic21midic14massigninitc21initc14ctrlinitctrl7ctrl21ctrl14chanctrlaftouch!Csound.Typed.Opcode.PluginHosting vstprogsetvstparamgetvstparamsetvstnote vstmidioutvstinitvstinfovsteditvstbankload vstaudiogvstaudiodssilistdssiinitdssictls dssiaudiodssiactivate#Csound.Typed.Opcode.PitchConverterscpsxpchcpstunicpstuncps2pchsemitonepchtompchoct pchmidinnoctpch octmidinnoctcpsoctaventommtonmtofftomcpspchcpsoct cpsmidinncentCsound.Typed.Opcode.OSCoscRawCsound.Typed.Opcode.Networkstsend socksendssocksendstrecv sockrecvssockrecv remoteport Csound.Typed.Opcode.MixerOpcodesmixerSetLevel_i mixerSetLevel mixerSendmixerReceive mixerGetLevel mixerClear!Csound.Typed.Opcode.Miscellaneous tableshuffleitableshufflesystemsystem_iselectpwd modmatrix fareylenifareylen directory*Csound.Typed.Opcode.MathematicalOperationstaninv2sum'product'pow polynomialmacamacdivzrndbirnddbfsampdbampampdbfsampdbvincrclear Csound.Typed.Opcode.JackoOpcodesjackoTransportjackoOnjackoNoteOutjackoMidiOutConnectjackoMidiOutjackoMidiInConnect jackoInitjackoAudioOutConnect jackoAudioOutjackoAudioInConnectjackoAudioIn%Csound.Typed.Opcode.InstrumentControltimestimek timeinsts timeinstkrtclock readclockdatesdatesubinstrinitsubinstrstackpush_fpushpop_fpopxyinwritescratchwiisendwiirangewiidata wiiconnectvactroltrigseqtimedseqtempovaltempotempestsplitrigsetscorepossetctrlseqtime2seqtimesensekeyrmsrewindscorereadscratchptrackplltrack pitchamdfpitchpindexpeakpcountp5gdata p5gconnect miditempomidifilestatusjoystickgetcfgfollow2followcontrolcheckboxchanged2preallocmaxalloc jacktransportexitnowcpuprccpumeteractivescoreline_i scoreline schedwhenscheduleschedkwhennamed schedkwhenremove readscorenstancemuteevent_ieventturnonturnoffiholdevalstr compilestr compileorc compilecsdclockonclockoff*Csound.Typed.Opcode.ImageProcessingOpcodes imagesize imagesetpixel imagesave imageload imagegetpixel imagefreeimagecreate Csound.Typed.Opcode.FaustOpcodesfaustctlCsound.Typed.Opcode.FLTKflShow flSetTextType flSetTextSizeflSetTextColor flSetText flSetSize flSetPosition flSetFontflSetColor2 flSetColorflSetBox flSetAlignflLabelflHideflColor2flColor vphasesegflXyinflVslidBnk2 flVslidBnkflVkeybdflValueflUpdate flSlidBnkSetkflSlidBnkSetflSlidBnkGetHandleflSlidBnk2Setk flSlidBnk2Set flSlidBnk2 flSlidBnk flSetVal_iflSetValflSetSnapGroup flSetsnap flSavesnapflRun flPrintk2flPrintkflMouse flLoadsnapflKeyInflHvsBoxSetValueflHvsBox flGetsnapflExecButton flCloseButtonflButton flButBankflBoxflTextflSliderflRollerflKnobflJoyflCount flTabsEndflTabsflScrollEndflScroll flPanelEndflPanel flPackEndflPack flGroupEndflGroup&Csound.Typed.Opcode.AbletonLinkOpcodeslink_tempo_setlink_tempo_get link_peers link_metrolink_is_enabledableton_link_enablelink_createlink_beat_request link_beat_getlink_beat_forceCsound.Typed.RendersaveUserOptionsCsound.Typed.ControlsetDurCsound.Typed.Control.ApitrigByNameMiditrigByNameMidi_ trigByNametrigByName_"Csound.Typed.Control.ArrayTraversefoldColumnsArrDfoldRowsArrD foldColumnArr foldRowArrfoldArr forColumnArrD forRowArrDforColumnArr forRowArrforeachArrD foreachArrCsound.Typed.Control.Evt monoSchedschedHarpBy schedHarpschedBysched_schedCsound.Typed.Control.InstrRefturnoff2noteOffnoteOnnewOutInstraddFracInstrRefnegateInstrRef scheduleEventnewInstrInstrRefCsound.Typed.Control.Midipgmidi_midin_midi_pgmidiCsound.Typed.Control.OsclistenOscValsendOsc listenOscinitOscOscRefOscPort OscAddressOscTypeOscHostOscValCsound.Typed.Control.Channel chnSetStr chnSetCtrl chnSetSigchnSetD chnGetStr chnGetSig chnGetCtrlchnGetDCsound.Typed.Control.Mixmix_mixBymixmonoScoeffsco_scoMixScoCsound.Typed.Control.MacrosArgs readMacrosIntreadMacrosDoublereadMacrosStringCsound.Typed.Control.Sf2SfCsound.Typed.Control.VcobloscSyncAbsBy' sqrSyncAbsBy'pulseSyncAbsBy' triSyncAbsBy'isawSyncAbsBy' sawSyncAbsBy'bloscSyncAbsBysqrSyncAbsBypulseSyncAbsBytriSyncAbsBy isawSyncAbsBysawSyncAbsBy bloscSyncAbs'sqrSyncAbs' pulseSyncAbs'triSyncAbs'isawSyncAbs'sawSyncAbs'bloscSyncAbs sqrSyncAbspulseSyncAbs triSyncAbsisawSyncAbs sawSyncAbsbloscSyncBy' sqrSyncBy'pulseSyncBy' triSyncBy'isawSyncBy' sawSyncBy'bloscSyncBy sqrSyncBypulseSyncBy triSyncBy isawSyncBy sawSyncBy bloscSync'sqrSync' pulseSync'triSync' isawSync'sawSync' bloscSyncsqrSync pulseSynctriSyncisawSyncsawSyncblosc'sqr'pulse'tri'isaw'saw'bloscsqrpulsetriisawsawUserSyncTrapSyncTriSyncSawSyncRawSync SyncSmoothCsound.Typed.Gui.Widget sinkSlicesourceSlicekeyIn setSlidersetKnob setTogglesetToggleSigmeter setNumericbutBankSig1butBank1 butBankSigbutBank toggleSigtogglebuttonboxnumeric sliderBanksliderrollerknobjoycountcountSigsetTitledisplay sinkSourcesinksourcewidgetmscamvermhormapGuiSource mapSource keyPanelBypanelBykeyPanelpanel keyPanelspanelsInputOutputInnerWidgetSinkSource SinkSourceDisplayCsound.Typed.MischeadPan'headPan staticHeadPanhradPanFadeheadPanPhaseHeadPanSpec Csound.Typed.Plugins.AudaciouseqaudaciousEqCsound.Typed.Plugins.DiodenoNormDiodediodelinDiodeCsound.Typed.Plugins.Korg35korg_hpkorg_lp linKorg_hp linKorg_lpCsound.Typed.Plugins.TapeEcho tapeWritetapeReadCsound.Typed.Plugins.Zdfzladderzbr zdf2_notchzhpzbpzlpzdf2zap1zhp1zlp1zdf1)Csound.Typed.Plugins.ZeroDelayConvolutionzconv'zconvzconvNp zconvRatio zconvPartSize ZConvSpecCsound.Typed.TypeswithSeedwithTabwithTabswithSigwithSigswithDwithDs withInitsCsound.Typed.Types.EvtsyncsteppersnapsreadSnapsnapshotfilterAccumE filterAccumSEaccumSEfilterSEfilterEsigToEvt boolToEvtrunEvtEvtBamSnapCsound.Typed.Gui.CabcabbageCsound.Typed.Types.MonoArgmonoAdsradsrMonoSyntmonoTrigmonoGatemonoCpsmonoAmpMonoArgMonoAdsrCsound.Typed.Plugins.Adsr140adsr140Csound.Typed.Plugins.Utilitiesdelay1kCsound.Typed.Control.RefwhileRefnewGlobalTabnewTabnewClearableGlobalRefglobalSensorsSEnewGlobalCtrlRefnewGlobalRef sensorsSE modifyRefmixRef newCtrlRefnewRefreadRefwriteRefRefCsound.Typed.Types.ArrayphsArrayCopy magsArrayCopyc2rCopyr2cCopywindowArrayCopy pol2rect2Copypol2rectCopyrect2polCopy cmplxprodCopy rifftCopyrfftCopy fftinvCopyfftCopyslicearrayCopymaparrayCopyphsArrayNewmagsArrayNewc2rNewr2cNewwindowArrayNewpol2rect2Newpol2rectNewrect2polNewcmplxprodNewtab2pvspvs2tabrifftNewrfftNew fftinvNewfftNew slicearrayNew scalearraysumarraymaxarrayminarraymaparrayNew copya2ftabcopyf2arraylenarraymixArr modifyArrwriteArrreadArrfillGlobalCtrlArrfillLocalCtrlArr fillGlobalArrfillLocalArrnewGlobalCtrlArrnewLocalCtrlArrnewGlobalArrnewLocalArrdarr3arr3darr2arr2darr1arr1Arr1DArr1Arr2DArr2Arr3DArr3ArrSpecArrCsound.Typed.Types.TuplecaseArg guardedArgifArg caseTupleguardedTupleifTuplear8ar6ar4ar2ar1makeTupleMethodstupleMethodsTupleSigsArgcfdscfd4cfduonmul2'mul2mul'mulmapSigSigSpacebindSigBindSigmapSig2 SigSpace2bindSig2BindSig2atAtOutAtmixAtMixAtCsound.Typed.Types.PrimftcpsftsrftchnlsftlennsampgreaterThanEqualslessThanEqualsgreaterThanlessThannotEqualsToequalsToboolSigwhileDoDuntilDoDwhileDountilDowhenDswhenD1whenswhen1mod'div'rem'quot'round'int'floor'ceil'frac'sigirkrarsetBpmgetBpmgetBlockSizegetControlRate getSampleRateidurtextintdoublefromTabListDfromTabListtabList forceNormskipNormunitSigDStrSpecWspecSig2Sig3Sig4Sig5Sig6Sig8Sig2_2Sig2_3Sig2_4Sig2_5Sig2_6Sig2_7Sig2_8BoolSigBoolDUnitTabTabListfromEtoGEfromGEValSigOrDCsound.Typed.GlobalState.SESECsound.Typed.GlobalState.GEMsgReleasePressKeyEvtNumDotNum0Num3Num2Num1Num6Num5Num4Num9Num8Num7NumPlusNumEnterNumDelNumIns NumPgDownNumArrowDownNumEnd NumArrowRightNumSpaceNumArrowLeftNumPgUp NumArrowUpNumHomeNumSubNumMulNumDivNumLockPgDownEndDeletePgUpHomeInsert ArrowDown ArrowRight ArrowLeftArrowUp BackspaceRightWinKey LeftWinKeyRightAltLeftAltEnter RightCtrlLeftCtrl RightShift LeftShiftCapsLookScrollF12F11F10F9F8F7F6F5F4F3F2F1CharKeyKeyCsound.Typed.Gui.GuisetKnobType setOrient setButtonTypesetTextType setSliderTypesetEmphasissetFontTypesetFontSizesetTextColor setColors setColor2 setColor1 setBoxTypesetMaterialsetLabel setBorder forceProps resizeGuipropsmarginpaddingverScahorScascaspaceverhorGuiCsound.Typed.Gui.TypesuspanExpbspanuspanexpSpanlinSpanColorVerHorOrientvalSpanScalevalSpanDiapValSpan valDiapMax valDiapMinValDiapExponentialLinearValScaleTypeValStepDingbatsScreenSymbolTimesCourier HelveticaFontType BoldItalicBoldItalic NoEmphasisEmphasisFlatClockPieThreeDKnobTypeNiceEngravedFill SliderTypeNoEditNoDrag NormalTextTextTypePlastic NoPlasticMaterialOvalFlatBox OvalShadowBoxOvalBoxDiamondDownBoxDiamondUpBoxRoundedDownBoxRoundedUpBoxRoundedFlatBoxRoundedShadowBox Roundedbox ShadowBox BorderBoxEmbossedBoxEngravedBoxThinDownBox ThinUpBoxDownBoxUpBoxFlatBoxBoxTypeThinUpThinDown BlackLineEmbossedBorderEngravedBorderUpBoxBorder DownBoxBorderNoBorder BorderTypeRoundButtonCheckButtonLightButtonNormalButton ButtonTypeScaleFactorSetLabelTypeSetKnobType SetOrient SetButtonTypeSetTextType SetSliderTypeSetEmphasisSetFontTypeSetFontSizeSetTextColor SetColor2 SetColor1 SetBoxTypeSetMaterialSetLabelProp Csound.Typed.Gui.Cabbage.Cabbage updateratedisplaytypezoomscrubberpos fontstyle scrollbarskeywidthmiddlecshowchildplant guirefreshpluginidsizerange2range linethicknesstrackerthicknesstextbox'minmax sliderincralignchanneltypecornersshapefilepopulatesvgfile popuptextwidgetarraycaptionvisiblealpharotateidentchannellatchedfontcolour1fontcolour0 fontcolour outlinecolour trackercolour textcolourbackgroundcolourcolour1colour0colourvaluetext2text1channelboundsxypad texteditortextbox signaldisplay soundfilerrslidervsliderhsliderlabelkeyboardimagegroupboxformvrangehrangegentableencodercsoundoutputcombobox infobutton filebuttonCabCabPropRgbHashColCsound.Typed.Gui.BoxModelheightwidthpypxRect Csound.Typed.GlobalState.Options idPadsynthidWaveidFareyidSoneidExpidTanhidMp3sidWins idBesselsidChebs2idChebs1idPolys idSplinesidStartEndsidExpsidCubesidLinsidConstsidBuzzesidSines4 idPartialsidSines2idSines3idSines idDoublesidWavscoarseFifineFicsdTracecsdJackConnectcsdJacko csdScaleUIcsdTabFicsdGaincsdBlockSize csdSampleRatecsdFlagsOptionsTabFi!Csound.Typed.GlobalState.ElementsChannelCsound.Typed.ConstantsinfiniteDur+temporal-media-0.6.3-KLuDeiL0qJfClCS0R8ZfFKTemporal.Media mapEventstempeventContenteventDur eventStartEventTemporal.ClassdurstreucscoBpmtrnbnwnhnqnensntndotddotdbndwndhndqndendsndtnwnrbnrhnrqnrenrsnrtnrdbnrdwnrdhnrdqnrdenrdsnrdtnrgrid ListenOsclistenOscSig listenOscSig2OutsSigOutstoOutsonArgCpsInstrCpsInstrOutonCpsAmpInstrAmpInstrOutonAmpsetRatessetBufssetGainsetJacksetJackosetCoreAudiosetAlsasetMmesetDacsetAdcsetInput setOutputsetDacBysetAdcBysetThru setSilent setMidiDevicesetMasetMessageLevel noMessagessetTrace setCabbagesetJackConnectcfdSpeccfdSpec4cfdsSpecwsumbatbmixAt FlatFilterResonFilterlphpbpbralpbhpblpbbpbbrmlpslidesmoothtoResonfiltflatFiltlp18mlp2mlp3lp1hp1bp2br2formantsingAsingOsingEsingUsingO2alp1alp2alp3alp4ahplpCheb1lpCheb1'lpCheb2lpCheb2'clpclp'hpCheb1hpCheb1'hpCheb2hpCheb2'chpchp'bpCheb1bpCheb1'bpCheb2bpCheb2'cbpcbp'cheb1cheb1'cheb2cheb2'vcfvcf'ladderplasticwobbletrumpyharshtbfslpshpsbpsbr multiStatevar multiSvfilterzubpzapzpeakfdiodekorg_bp linKorg_bpklpkhpkbpNormTabSpecScanLeftToRightScanFromMiddle PadsynthShape GaussShapeSquareShapeExpShapePadsynthSpecpadsynthFundamentalpadsynthBandwidthpadsynthPartialScalepadsynthHarmonicStretch padsynthShapepadsynthShapeParameterpadsynthHarmonics PartialDCPartialPhasePartialStrength PartialNumberMp3ChnMp3Mono Mp3StereoMp3LeftMp3RightMp3AllWavChnWavLeftWavRightWavAllnoTabtabSizeSeconds tabSizePower2tabSizeSecondsPower2wavswavAllwavLeftwavRightmp3smp3Leftmp3Rightmp3mdoublesexpseexpscubesecubeslinselinssplinesesplinesconstseconsts startEnds estartEndsbpLinsbpExpssinessines1sines2sines3sines4bwSines bwOddSinessinecosinesigmoidsigmoidRisesigmoidFalltanhSigmoidbuzzesbesselspolyschebs1chebs2 winHamming winHanningwinBartlettwinBlackman winHarriswinRectanglewinSyncwinGauss winKaiserdefPadsynthSpecpadsynthgen guardPointgpsetSize setDegreelllofillofilofimidfihifihhifihhhifitablewasec2reltabDurtabHarmonicsmixOnTabmixTabsnormTabscaleTabtabsegetabseguniDistlinDisttriDistexpDist biexpDist gaussDist cauchyDistpcauchyDistbetaDistweibullDistpoissonDistuniDist'linDist'triDist'expDist' biexpDist' gaussDist'cauchyDist'pcauchyDist' betaDist'weibullDist'poissonDist'tabDistrandDist rangeDistreadNumFilereadTrajectoryFile readPvocexreadMultichannel tabSines1 tabSines2 waveletTabrescaleWaveletTabtriTabsawTabsqrTabpwTabtanhTabrescaleTanhTabexpTab rescaleExpTabsoneTabrescaleSoneTabfareyTabtablewreadTab readTable readTable3 readTableitableikttablekttablexktcuserrndduserrnd$fDefaultWavChn$fDefaultMp3Chn$fShowPadsynthSpec$fEqPadsynthSpec$fShowPadsynthShape$fEqPadsynthShape$fOrdPadsynthShape$fEnumPadsynthShape$fShowMp3Chn $fEqMp3Chn$fShowWavChn $fEqWavChnLfoWaveoscosc'oscBy'unipolarbipolaruoscuoscByusawuisawusqrutriupulseubloscurspline birsplinefoscpwpw'rampramp'upwurampuosc'uoscBy'usaw'uisaw'upulse'usqr'upw'utri'uramp'ublosc'rndPhsrndOscrndOscByrndSawrndIsawrndPulserndSqrrndPwrndTrirndRamprndBloscurndOsc urndOscByurndSawurndIsaw urndPulseurndSqrurndPwurndTriurndRamp urndBloscrndhrndiurndhurndiwhitepinkbrownlfodetunemultiHz multiCentmultiRnd multiGauss multiRndSEmultiGaussSEbuzbuz'gbuzgbuz'rawTrirawSawrawSqrrawPwrawTri'rawSaw'rawSqr'rawPw' rndRawTri rndRawSaw rndRawSqrrndRawPwurawTriurawSawurawSqrurawPwurawTri'urawSaw'urawSqr'urawPw' urndRawTri urndRawSaw urndRawSqr urndRawPwloscCfd'loscCfdrosclosclosc3monoLoscldiskrdiskldisk1rdisk1 rndSawSyncrndIsawSyncrndPulseSync rndSqrSync rndTriSyncrndBloscSyncrawTriSyncByrawSqrSyncByrawSawSyncByrawPwSyncBy rawTriSync rawSqrSync rawSawSync rawPwSyncrawTriSyncAbsByrawSqrSyncAbsByrawSawSyncAbsByrawPwSyncAbsBy rawTriSyncAbs rawSqrSyncAbs rawSawSyncAbsrawPwSyncAbssoftSyncrawSoftSync softSyncBy rawSoftSyncBysoftSyncAbsrawSoftSyncAbs softSyncAbsByrawSoftSyncAbsByFmGraphfmGraphfmGraphOutsFmSpecfmWavefmCpsfmIndfmOutsFmNodeFmfmOsc'fmOscfmSigfmodfmOutfmOut1fmOut2fmRundx_1dx_2dx_3dx_4 CrossSpeccrossFftcrossHopSize crossScale crossPitchcrossMaxTrackscrossWinTypecrossSearch crossDepthcrossThreshcrossMinPointscrossMaxGaptoSpecfromSpecmapSpec scaleSpecaddSpec scalePitchcrossSpecFiltercrossSpecVocodercrossSpecFilter1crossSpecVocoder1$fDefaultCrossSpec HvsMatrix3 HvsMatrix2 HvsMatrix1HvsSnapshotcsdHvs1csdHvs2csdHvs3RandomSpreadSigEchoGainFftSizeRatioSigTremWaveSigFoldoverSigBitsReductionSigTimeSig ResonanceBaseCpsSensitivitySigDriveSigToneSigWidthSigRateSigDepthSigPingPongSpecpingPongMaxTimepingPongDamp pingPongWidthBalanceFeedback DelayTimeMaxDelayTime reverbsc1 reverTimerever1rever2 smallRoom smallHall largeHall magicCave smallRoom2 smallHall2 largeHall2 magicCave2roomchamberhallcavemonoIRmonoIR'stereoIR stereoIR' stereoIR2 stereoIR2'pmonoIR pstereoIR pstereoIR2echofvdelayfvdelays funDelaystabDelaypingPong pingPong'csdPingPong distortionchorusflangephase1 harmPhase powerPhase fxDistort stChorus2analogDelayfxFilter equalizereq7eq4fxGainfxWhitefxPinkfxEcho trackerSplicepitchShifterDelay fxAnalogDelayfxDistortion fxFollower fxReverse fxFlangerfxPhaserfxLoFi fxChorus2 fxAutoPanfxTremfxPitchShifter fxFreqShifter fxCompresstapeEcho$fDefaultPingPongSpecatArgatTuple whenElseDwhenElsecompareWhenDsyntaktTempList unTempListTempunTempgenTempgenTempRatio tempRatioCtempCstdTempRatiostdTempbarTempRatiobarTemp ratioConcertAconcertAtempListfromTempList fromTempListD cent2ratio ratio2centequalCents1 justCents1 meantoneCents pythagorCentswerckmeisterCentsyoungCents1youngCents2youngCents3equal1just1meantonepythagorwerckmeisteryoung1young2young3 $fArgTemp$fTupleTemp $fDefaultTemp $fArgTempList$fTupleTempList MidiInstrTemponMsg' MidiInstrMidiInstrOutonMsgRndsTickevtToSig evtToBool evtToTrigdevtmetroEmetroSig gaussTrigdustdustSigdustSig2loadbangimpulseimpulseE eventListchangedEtriggerEsyncBpm partitionEsplitTogglesnaps2cycleElistAtrandIntsrandDsrandListrandSkip randSkipByiterateErepeatEappendEmappendEoneOffreqOf freqAccumeverymaskedtoTogtoTog1takeEdropE takeWhileE dropWhileEdelEvtmixLoopmixLoop_ schedUntilschedToggleschedUntil_playWhenschedStreamwithDurretrigalwaysOn turnoffByNameMidiFunMidiChnChnAllChnPgm toMidiFun toMidiFun_ampCps ampmidinnampCps'cpsmidi' cpsmidi'Dcpsmidi'SigmonoMsgmonoMsgTemp genMonoMsggenMonoMsgTemp smoothMonoArggenFilteredMonoMsggenFilteredMonoMsgTempholdMsgholdMsgTemp trigNamedMononamedAmpCpsSig midiKeyOn midiKeyOffinitc7 midiCtrl7midiCtrl umidiCtrl midiCtrl7A midiCtrlA umidiCtrlAtryMiditryMidi' $fShowMidiChn$fEqMidiChnsf2sfTempsfMsgsfMsg3sfMsgmsfMsg3msfMsgLooper sfMsgTemp sfMsgTemp3 sfMsgTempmsfMsgTemp3msfMsgLooperTempsfKeysfKey3sfKeymsfKey3msfKeyLoopersfCpssfCps3sfCpsmsfCps3msfCpsLooperRangeradioButtonmatrixButton funnyRadiofunnyMatrixcharOncharOffstrOnstrOffuslideruknobxsliderxknobujoyhnumbersvnumbersknobPad togglePad buttonPadgenPadhradiovradio hradioSig vradioSigrangeKnobSigrangeSliderSig rangeKnobrangeSliderrangeJoy rangeJoy2rangeJoySigbutton'toggle' toggleSig'uknob'uslider'knob'slider' hradioSig' vradioSig'hradio'vradio'winkeyWin joinSource fromSourcefromSourceSEresizeSourcehliftsvlifts gridLiftshlifts'vlifts'lift1hlift2vlift2hlift2'vlift2'hlift3vlift3hlift3'vlift3'hlift4vlift4hlift4'vlift4'hlift5vlift5hlift5'vlift5'hbindvbindhapplyvapplyhbind'vbind'happly'vapply'hmapMvmapMhmapM'vmapM'gridMapM$fAt(,)SESE$fAt(,)(,)SE$fAtSigSESE$fSigSpaceSE RenderCsdrenderCsdBycsdArityCsdAritycsdArity'inputscsdArity'outputswriteCsd writeCsdBywriteSnd writeSndBy playCsdBydacByvdacvdacBycsdcsdBymplayer mplayerBytotemtotemBy runCabbagerunCabbageByonCard1onCard2onCard4onCard6onCard8 $fRenderCsdSE$fRenderCsdSE0 $fRenderCsd->$fRenderCsd->0$fRenderCsd->1$fRenderCsd->2$fRenderCsd->3 $fRenderCsd[]$fRenderCsdTrack$fRenderCsdSE1$fRenderCsdSE2$fRenderCsdSE3$fRenderCsda$fRenderCsdSE4$fShowCsdArity$fEqCsdArityPitchSigTempoSigFidelityPhsrphsrFile phsrStartphsrEnd phsrSpeedSampleFormatNoHeaderFloat32 NoHeaderInt16HeaderInt16UlawSamplesInt16Int32Float32Uint8Int24Float64LoopModeOnceLoopBouncetakeSnddelaySnd segmentSnd repeatSndafterSndlineSndloopLineSndtoMono lengthSndsegmentsreadSnd loopSndByloopSndreadWavloopWav readSegWavtempoReadWavtempoLoopWavreadSnd1 loopSndBy1loopSnd1readWav1loopWav1readSegWav1 tempoReadWav1 tempoLoopWav1ramSndramSnd1 writeSigswriteWavdumpWavdumpWav1 writeAiff writeWav1 writeAiff1ramTablphasephsrOnce phsrBouncerelPhsrsndPhsrram1ramreadRamloopRamreadSegloopSegreadRelloopRelreadRam1loopRam1readSeg1loopSeg1readRel1loopRel1 scaleDrum scaleHarm scaleDrum1 scaleHarm1 scaleWav1scaleWav$fEqSampleFormat$fOrdSampleFormat$fEnumSampleFormat$fShowLoopMode$fEqLoopMode$fEnumLoopModeSegtoSegconstLimlimSndrunSeg constRestconstDel $fLimitSeg $fRestSeg $fLoopSeg $fDelaySeg$fComposeSeg$fHarmonySeg$fMelodySeg $fSigSpaceSeg$fFunctorSegMidiTrigFunevtTrigsyncEvtTrig syncEvtToggleevtTap syncEvtTapevtGroupsyncEvtGroupevtCyclesyncEvtCyclecharTrigsyncCharTrigcharPushsyncCharPush charTogglesyncCharTogglecharTapsyncCharTap charGroup syncCharGroup charCycle syncCharCyclemidiAmpInstrmidiLpInstrmidiAudioLpInstrmidiConstInstrmidiTrigmidiTapmidiPush midiToggle midiGroup midiTrigBy midiTapBy midiPushBymidiToggleBymidiGroupBy keyColumn1 keyColumn2 keyColumn3 keyColumn4 keyColumn5 keyColumn6 keyColumn7 keyColumn8 keyColumn9 keyColumn0 keyColumnsheadPan2 headPan2'staticHeadPan2 headPanNetheadPanNet2Fof2Specfof2TimeModfof2PitchModfof2Octfof2Bandfof2Rise fof2Decay fof2Glissfof2WinSndwarpSpecsndwarpWinSizesndwarpRandwsndwarpOvelrap sndwarpWinRndSyncgrainSpecrndSyncTimescalerndSyncgrainPitchrndSyncgrainGrainDur SyncgrainSpecsyncgrainWinsyncgrainOverlapGranuleSpec granuleGapgranuleVoicegranuleRatiogranuleModegranuleSkip_os granuleGap_osgranuleSize_osgranuleSeed granuleAtt granuleDecGranuleModeGranuleForwardGranuleBackward GranuleRandom RndGrainySpecrndGrainyPitchrndGrainyPosrndGrainyDur PartikkelSpecpartikkelDistributionpartikkelDisttab partikkelSyncpartikkelEnv2amtpartikkelEnv2tabpartikkelEnv_attackpartikkelEnv_decaypartikkelSustain_amountpartikkelA_d_ratiopartikkelAmppartikkelGainmaskspartikkelSweepshapepartikkelWavfreqstarttabpartikkelWavfreqendtabpartikkelWavfmpartikkelFmamptabpartikkelFmenvpartikkelCosinepartikkelNumpartialspartikkelChromapartikkelChannelmaskspartikkelRandommaskpartikkelWaveamptabpartikkelWavekeyspartikkelMax_grains ConstPitchSigPointer GrainSize GrainRate partikkelgrainy1grainy rndGrainy1 rndGrainy ptrGrainyptrGrainySnd ptrGrainySnd1rndPtrGrainygranule granuleSndgranuleSnd1 syncgrainrndSyncgrainsyncgrainSnd syncgrainSnd1rndSyncgrainSndrndSyncgrainSnd1sndwarp sndwarpst sndwarpSndsndwarpSnd1 ptrSndwarpptrSndwarpst ptrSndwarpSndptrSndwarpSnd1fof2Sndfof2Snd1fof2fofDelaygrainyDelayrndGrainyDelaysndwarpDelaysyncgrainDelayrndSyncgrainDelaypartikkelDelaygrainyFxrndGrainyFx sndwarpFxsyncgrainFxrndSyncgrainFxpartikkelFxfofFxcsdPartikkelcsdSyncgrain csdGranule csdSndwarpcsdSndwarpst$fDefaultPartikkelSpec$fDefaultRndGrainySpec$fDefaultGranuleMode$fDefaultGranuleSpec$fDefaultSyncgrainSpec$fDefaultRndSyncgrainSpec$fDefaultSndwarpSpec$fDefaultFof2Spec MorphSpecmorphGrainDensity morphGrainEnvGrainEnv grainAttShape grainDecShapegrainSustRatiograinAttDecRatioGrainDensity grainRate grainSize grainSkip MorphWaveWaveKeyWaveAmpmorpheuspairToSquare morphSnd1morphSndmorpheusOscmorpheusOsc2$fDefaultGrainDensity$fDefaultGrainEnv$fDefaultMorphSpecHumanizeValueTimeHumanizeValueTimeOuthumanValTimeHumanizeTimeHumanizeTimeOut humanTime HumanizeValueHumanizeValueOuthumanValSeqlegxegonIduronDurlindurexpdurlindurByexpdurBylinendur linendurByfadeInfadeOutslopeexpSlope expFadeIn expFadeOutfadesexpFadesstepSeqsahlinloopexploopconstSeqtriSeqsqrSeqsawSeqisqrSeqisawSeqxsawSeqixsawSeqxtriSeqpwSeqipwSeqrampSeqxrampSeqirampSeq ixrampSeqlpsholdloopsegloopxseg lpsholdBy loopsegBy loopxsegByadsrSeqxadsrSeqadsrSeq_ xadsrSeq_holdSeqlinSeqexpSeqtoSeqonBeatonBeatsseqConstseqLinseqExpseqPwiseqPwseqSqriseqSqrseqSawiseqSawxseqSawixseqSawseqRampiseqRampseqTri seqTriRampseqAdsrxseqAdsrseqAdsr_ xseqAdsr_seqPatseqDescseqAscseqHalfhvalhtimehvalTimetrigTab trigTabEvt$fFractionalSeq$fNumSeq$fStretchSeq$fMelodySeq $fDelaySeq $fRestSeq $fDurationSeq$fHumanizeValue->$fHumanizeValue->0$fHumanizeValue->1$fHumanizeValue->2$fHumanizeTime->$fHumanizeTime->0$fHumanizeTime->1$fHumanizeValueTime->$fHumanizeValueTime->0$fHumanizeValueTime->1ModArg4 ModArgOut4modArg4ModArg3 ModArgOut3modArg3ModArg2 ModArgOut2modArg2ModArg1 ModArgOut1modArg1 delModArg1 delModArg2 delModArg3 delModArg4adsrArg1adsrArg2adsrArg3adsrArg4delAdsrArg1delAdsrArg2delAdsrArg3delAdsrArg4 xadsrArg1 xadsrArg2 xadsrArg3 xadsrArg4delXadsrArg1delXadsrArg2delXadsrArg3delXadsrArg4oscArg1oscArg2oscArg3oscArg4 delOscArg1 delOscArg2 delOscArg3 delOscArg4triArg1triArg2triArg3triArg4 delTriArg1 delTriArg2 delTriArg3 delTriArg4sqrArg1sqrArg2sqrArg3sqrArg4 delSqrArg1 delSqrArg2 delSqrArg3 delSqrArg4sawArg1sawArg2sawArg3sawArg4 delSawArg1 delSawArg2 delSawArg3 delSawArg4 rndOscArg1 rndOscArg2 rndOscArg3 rndOscArg4 delRndOscArg1 delRndOscArg2 delRndOscArg3 delRndOscArg4 rndTriArg1 rndTriArg2 rndTriArg3 rndTriArg4 delRndTriArg1 delRndTriArg2 delRndTriArg3 delRndTriArg4 rndSqrArg1 rndSqrArg2 rndSqrArg3 rndSqrArg4 delRndSqrArg1 delRndSqrArg2 delRndSqrArg3 delRndSqrArg4 rndSawArg1 rndSawArg2 rndSawArg3 rndSawArg4 delRndSawArg1 delRndSawArg2 delRndSawArg3 delRndSawArg4 noiseArg1 noiseArg2 noiseArg3 noiseArg4delNoiseArg1delNoiseArg2delNoiseArg3delNoiseArg4pinkArg1pinkArg2pinkArg3pinkArg4delPinkArg1delPinkArg2delPinkArg3delPinkArg4jitArg1jitArg2jitArg3jitArg4 delJitArg1 delJitArg2 delJitArg3 delJitArg4 gaussArg1 gaussArg2 gaussArg3 gaussArg4delGaussArg1delGaussArg2delGaussArg3delGaussArg4 gaussiArg1 gaussiArg2 gaussiArg3 gaussiArg4 delGaussiArg1 delGaussiArg2 delGaussiArg3 delGaussiArg4 $fModArg1SE->$fModArg1SE->0$fModArg1SE->1$fModArg1SE->2$fModArg1SE->3$fModArg1SE->4$fModArg1SE->5$fModArg1SE->6$fModArg1SE->7$fModArg1SE->8$fModArg1SE->9$fModArg1SE->10$fModArg1SE->11$fModArg1SE->12$fModArg1SE->13$fModArg1SE->14$fModArg1Sig->$fModArg1Sig->0$fModArg1Sig->1$fModArg1Sig->2$fModArg1Sig->3$fModArg1Sig->4$fModArg1Sig->5$fModArg1Sig->6$fModArg1Sig->7$fModArg1Sig->8$fModArg1Sig->9$fModArg1Sig->10$fModArg1Sig->11$fModArg1Sig->12$fModArg1Sig->13$fModArg1Sig->14 $fModArg2SE->$fModArg2SE->0$fModArg2SE->1$fModArg2SE->2$fModArg2SE->3$fModArg2SE->4$fModArg2SE->5$fModArg2SE->6$fModArg2SE->7$fModArg2SE->8$fModArg2SE->9$fModArg2SE->10$fModArg2Sig->$fModArg2Sig->0$fModArg2Sig->1$fModArg2Sig->2$fModArg2Sig->3$fModArg2Sig->4$fModArg2Sig->5$fModArg2Sig->6$fModArg2Sig->7$fModArg2Sig->8$fModArg2Sig->9$fModArg2Sig->10 $fModArg3SE->$fModArg3SE->0$fModArg3SE->1$fModArg3SE->2$fModArg3SE->3$fModArg3SE->4$fModArg3SE->5$fModArg3SE->6$fModArg3Sig->$fModArg3Sig->0$fModArg3Sig->1$fModArg3Sig->2$fModArg3Sig->3$fModArg3Sig->4$fModArg3Sig->5$fModArg3Sig->6 $fModArg4SE->$fModArg4SE->0$fModArg4SE->1$fModArg4SE->2$fModArg4Sig->$fModArg4Sig->0$fModArg4Sig->1$fModArg4Sig->2PatchMonoSyntPolySyntSetSkinFxChain SplitPatch LayerPatchPolySyntSpecpolySyntChnMonoSyntSpecmonoSyntChnmonoSyntSlideTimePatch2Patch1FxSpecfxMixfxFunFx2Fx1DryWetRatioFxInstrCsdNote MonoInstrGenMonoInstr GenFxSpecGenInstrSyntSkinpolySyntpolySyntFilteradsrMonoadsrMonoFiltermonoSyntmonoSyntFilterfxSpecfxSpecFiltermapMonoPolyInstr mapPatchInstrdryPatchsetFxMix setFxMixes getPatchFxatNoteatMidi atMidiTempatSchedatSchedUntilatSchedHarpatScoonMonoSyntSpec setMidiChnsetMonoSharpsetMonoSlide transPatch addInstrFxaddPreFx addPostFx patchWhenmixInstrharmonPatchdeepPad withSmallRoomwithSmallRoom' withSmallHallwithSmallHall' withLargeHallwithLargeHall' withMagicCavewithMagicCave'sfPatchHallsfPatchpatchByNameMidipatchByNameMidiTempfxSigfxSigMixfxSig2 fxSigMix2mapFxmapFx'bindFxbindFx'mapPreFx mapPreFx' bindPreFx bindPreFx'$fDefaultMonoSyntSpec$fDefaultPolySyntSpec$fSigSpacePatch$fRenderCsdPatch$fRenderCsdPatch0oddsevensonceonceByseveralmeanvibraterandomPitchchorusPitchresonsresonsBydryWetmodesfromMonorndPan2rndPangaussVolrndVol writeHifiselectorarpeggiarpBylpJoyfunSeqfunPardelaySignticksnticks2nticks3nticks4ticksticks2ticks3ticks4 testDrone testDrone2 testDrone3 testDrone4wshapergenSaturator mildSaturator saturator hardSaturatorhardSaturator2 attackTrig attackTrigSigambiEnv$fDefaultRazorPadLoopControlloopTaploopFadeloopDelloopThroughLoopSpec loopMixVal loopPrefx loopPostfxloopPrefxVal loopPostfxVal loopInitInstr loopFadesloopRepeatFadesloopControlsfLoopmidiLoopsigLoop$fDefaultLoopControl$fDefaultLoopSpec ClipParam clipParamSizeclipParamDel clipParamTail clipParamNextclipParamRetrigclipParamVolLiveClipliveClipFile liveClipParamAdsrInitattInitdecInitsusInitrelInit AdsrBoundattBounddecBoundrelBoundmixerhmixermixMonofxBoxuiBoxfxColorfxScafxHorfxVerfxGridfxHorMSfxVerMSfxGridMSfxApplyfxMapatFx uiDistortuiChorusuiDry uiFlangeruiPhaseruiDelayuiEchouiFilteruiReverbuiGainuiWhiteuiPinkuiFxuiMidiuiSiguiMixlinAdsrexpAdsrclassicWavesmasterVolumemasterVolumeKnobhmidiChooservmidiChooser hinstrChooser vinstrChooser uiCompress fromMonoFxliveRowliveRowsambiRow ambiRowMp3$fDefaultClipParamEnvelopeModSigadeletortfowlerrevsyflanphasycrusherchorypanyoscPanytriPanysqrPanytremyoscTremytriTremysqrTremyringoadele1adele2adele3adele4adele5adele1badele2badele3badele4badele5badele1madele2madele3madele4madele5mmagnuspongypongy1pongy2pongy3pongy4pongy5pongy1bpongy2bpongy3bpongy4bpongy5bpongy1mpongy2mpongy3mpongy4mpongy5mtort1tort2tort3tort4tort5tort1btort2btort3btort4btort5btort1mtort2mtort3mtort4mtort5mfowler'fowler1fowler2fowler3fowler4fowler5flan'flan1flan2flan3flan4flan5phasy'phasy1phasy2phasy3phasy4phasy5chory'chory1chory2chory3chory4chory5oscPany'oscPany1oscPany2oscPany3oscPany4oscPany5triPany'triPany1triPany2triPany3triPany4triPany5sqrPany'sqrPany1sqrPany2sqrPany3sqrPany4sqrPany5 oscTremy' oscTremy1 oscTremy2 oscTremy3 oscTremy4 oscTremy5 triTremy' triTremy1 triTremy2 triTremy3 triTremy4 triTremy5 sqrTremy' sqrTremy1 sqrTremy2 sqrTremy3 sqrTremy4 sqrTremy5ringo'ringo1ringo2ringo3ringo4ringo5uiAdele1uiAdele2uiAdele3uiAdele4uiAdele5 uiAdele1b uiAdele2b uiAdele3b uiAdele4b uiAdele5b uiAdele1m uiAdele2m uiAdele3m uiAdele4m uiAdele5muiMagnusuiPongy1uiPongy2uiPongy3uiPongy4uiPongy5 uiPongy1b uiPongy2b uiPongy3b uiPongy4b uiPongy5b uiPongy1m uiPongy2m uiPongy3m uiPongy4m uiPongy5muiTort1uiTort2uiTort3uiTort4uiTort5uiTort1buiTort2buiTort3buiTort4buiTort5buiTort1muiTort2muiTort3muiTort4muiTort5m uiFowler' uiFowler1 uiFowler2 uiFowler3 uiFowler4 uiFowler5uiFlan'uiFlan1uiFlan2uiFlan3uiFlan4uiFlan5uiPhasy'uiPhasy1uiPhasy2uiPhasy3uiPhasy4uiPhasy5uiChory'uiChory1uiChory2uiChory3uiChory4uiChory5 uiOscPany' uiTriPany' uiSqrPany' uiOscPany1 uiOscPany2 uiOscPany3 uiOscPany4 uiOscPany5 uiTriPany1 uiTriPany2 uiTriPany3 uiTriPany4 uiTriPany5 uiSqrPany1 uiSqrPany2 uiSqrPany3 uiSqrPany4 uiSqrPany5uiOscTremy'uiTriTremy'uiSqrTremy'uiOscTremy1uiOscTremy2uiOscTremy3uiOscTremy4uiOscTremy5uiTriTremy1uiTriTremy2uiTriTremy3uiTriTremy4uiTriTremy5uiSqrTremy1uiSqrTremy2uiSqrTremy3uiSqrTremy4uiSqrTremy5uiRingo'uiRingo1uiRingo2uiRingo3uiRingo4uiRingo5 uiCrusheruiRevsyuiRoomuiRoom1uiRoom2uiRoom3uiRoom4uiRoom5 uiChamber uiChamber1 uiChamber2 uiChamber3 uiChamber4 uiChamber5uiHalluiHall1uiHall2uiHall3uiHall4uiHall5uiCaveuiCave1uiCave2uiCave3uiCave4uiCave5 uiMonoRoomuiRoom1muiRoom2muiRoom3muiRoom4muiRoom5m uiMonoChamberuiChamber1muiChamber2muiChamber3muiChamber4muiChamber5m uiMonoHalluiHall1muiHall2muiHall3muiHall4muiHall5m uiMonoCaveuiCave1muiCave2muiCave3muiCave4muiCave5m ambiGuitarpadsynthOscpadsynthOsc2padsynthOscMultiCpspadsynthOscMultiCps2padsynthOscMultiVolpadsynthOscMultiVol2padsynthOscMultiVolCpspadsynthOscMultiVolCps2bwOscBybwOscBy2 bwOddOscBybwOddOscBy2bwOscbwTribwSqrbwSawbwOsc2bwTri2bwSqr2bwSaw2morphsynthOscMultiCpsquadMorphsynthOscMultiCpsmemptymappendMonoid<>mconcat$Boolean-0.2.4-IiHA9kuDFTR8tOhuid2pCiData.Booleansort2BmaxBminBcaseBguardedBcropcondbooleanBoolean||*&&*notBtruefalse BooleanOfIfBifBEqB==*/=*OrdB>=*>*<*<=*Data.MonoidFirstgetFirstLastgetLastApgetApData.Semigroup.InternalDualgetDualEndoappEndoAllgetAllAnygetAnySumgetSumProduct getProductAltgetAlt1data-default-class-0.1.2.0-IIN1s3V8yfYEDHe5yjxXHVData.Default.ClassDefaultdef linfunRellinfun sortEventsalignByZerosustainTsustaintmapReltmapfilterEventstraverseEventswithineventEndrendersingleEvent fromEventdropTtakeTslicereflectharTMapharTempmelTempharT=:/nilTrackharMapmelMap*|+|loopByDurationDurOfMelodymel+:+Harmonyhar=:=ComposeDelaydelStretchRestrestLimitlimloop