h$=o      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          !!!!"""""""""""""""""""""""""""""""""""""""""""""""""##########%,Determine and manipulate bracket characters.hapytexeu+gh@gmail.com experimentalPOSIXSafeU<unicode-tricks(A data type that is used to specify the type of bracket.unicode-tricks(The bracket is used to "open" a context.unicode-tricks)The bracket is used to "close" a context. unicode-tricksA list of 2-tuples where the first item of each tuple is the opening bracket, and the second item its closing counterpart. unicode-tricks$The list of all brackets characters. unicode-tricks A list of %s that contains all opening brackets. unicode-tricks A list of %s that contains all closing brackets. unicode-tricksA  that maps the given  open bracket" characters to the corresponding  close bracket.unicode-tricksA  that maps the given  close bracket" characters to the corresponding  open bracket.unicode-tricksCheck if the given  is a bracket character.unicode-tricksCheck if the given  is an  open bracket.unicode-tricksCheck if the given  is a  close bracket.unicode-tricks Check the  of the  wrapped in a  data construct;  if the given  is not a bracket character.unicode-tricks Check the  of the . For a  that is not a bracket the behavior is unspecified.unicode-tricks&Get the bracket character that is the  counterpart of the given bracket character wrapped in a ! data constructor. If the given  is not a bracket,  is returned.unicode-tricks&Get the bracket character that is the  counterpart of the given bracket character. If the given  is not a bracket, the given  is returned. unicode-tricksThe list of all s that are brackets. unicode-tricksThe list of all  s that are opening brackets. unicode-tricksThe list of all  s that are closing brackets.unicode-tricks The given  to test.unicode-tricks if the given  is an open bracket;  otherwise.unicode-tricks The given  to test.unicode-tricks if the  is an  open bracket;  otherwise.unicode-tricks The given  to test.unicode-tricks if the  is an  close bracket;  otherwise.unicode-tricks The given 5 for which we want to determine the opposite bracket.unicode-tricks"The opposite bracket wrapped in a  if the given  is a bracket character;  otherwise.unicode-tricks The given 5 for which we want to determine the opposite bracket.unicode-tricks"The opposite bracket if the given  is a bracket; otherwise the given .   Visualizing control characters.hapytexeu+gh@gmail.com experimentalPOSIXSafea* unicode-tricksCheck if the given + is a control character in the ASCII range.unicode-tricksCheck if for the given  there is a visualization.unicode-tricks Another symbol used to denote a space that works with H. The $ function uses H. unicode-tricks Another symbol used to denote a space that works with H. The $ function uses H.!unicode-tricks Another symbol used to denote a new line that works with H$. The control picture function uses H."unicode-tricks Another symbol used to denote a delete character that works with H$. The control picture function uses H.#unicode-tricks Another symbol used to denote a  substitute character that works with H$. The control picture function uses H.$unicode-tricksConvert the given control  to a  that visualizes that characters. This is sometimes done by diagonal lettering of the characters denoting the control character. If the given  is not a control character,  is returned.%unicode-tricksConvert the given control  to a / that visualizes that character. If the given < is not a control character, it is unspecified what happens.&unicode-tricks-Convert the given visualization of a control  to that control  wrapped in a . If the given 1 is not a visualization of a control character,  is returned.'unicode-tricks-Convert the given visualization of a control  to that control . If the given  is not a visualization of a control character, it is unspecified what happens. unicode-tricks The given  to check.unicode-tricks if the given 6 is a control character in the ASCII range; otherwise .unicode-tricks The given  to check.unicode-tricks3 if the given control character can be visualized;  otherwise.unicode-tricksAnother character for space. unicode-tricksAnother character for space.!unicode-tricksAnother character for a new line."unicode-tricksAnother character for delete.#unicode-tricksAnother character for  substitute.$unicode-tricksThe given control  to convert.%unicode-tricksThe given control .unicode-tricksThe corresponding  that visualizes the control .&unicode-tricks The given  visualization of control .unicode-tricksThe corresponding control  wrapped in a  if the given character is the visualization of a control character; otherwise .'unicode-tricks The given  visualization of control .unicode-tricksThe corresponding control .  !"#$%&' $%&' !"#A module that defines data structures used in the other modules.hapytexeu+gh@gmail.com experimentalPOSIXSafe -5679>(unicode-tricksA class from which boejcts can be derived that map to and from a sequence of unicode characters.)unicode-tricksConvert the given object to a  object.*unicode-tricksConvert the given  to an object wrapped in a # data constructor if that exists;  otherwise.+unicode-tricksConvert the given  to an object. If the . does not map on an element, the behavior is  unspecified), it can for example result in an error.,unicode-tricksA class from which objects can be derived that map to and from a single unicode character.-unicode-tricks&Convert the given object to a Unicode acter..unicode-tricksConvert the given  acter to an object wrapped in a # data constructor if that exists;  otherwise./unicode-tricksConvert the given acter to an object. If the 3acter does not map on an element, the behavior is  unspecified), it can for example result in an error.0unicode-tricksAn alias of the , type class.1unicode-tricksSpecify if one should ligate, or not. When litigation is done characters that are normally written in two (or more) characters are combined in one character. For example B instead of BBB.2unicode-tricks7A ligate operation is performed on the characters, the  for 't:Ligate'.3unicode-tricks2No ligate operation is performed on the charaters.4unicode-tricks/A data type that specifies if the font is with serifs or not. The 'Defaul;t' is 6.5unicode-tricks&The character is a character rendered without serifs.6unicode-tricks&The character is a character rendered with serifs.7unicode-tricks.A data type that can be used to specify if an italic character is used. The  is 8.8unicode-tricksNo italic characters are used.9unicode-tricksItalic characters are used.:unicode-tricksA data type that lists the possible emphasis of a font. This can be < or ; the  is ;.;unicode-tricks.The characters are not stressed with boldface.<unicode-tricks(The characters are stressed in boldface.=unicode-tricksA data type that specifies that an item has been given a rotation.?unicode-tricksThe object that is rotated.@unicode-tricks#The rotation of the rotated object.Aunicode-tricksPossible rotations of a unicode character if that character can be rotated over 0, 90, 180, and 270 degrees.Bunicode-tricks No rotation.Cunicode-tricksRotation over 90 degrees.Dunicode-tricksRotation over 180 degrees.Eunicode-tricksRotation over 270 degrees.Funicode-tricksA data type that specifies that an item has been given an orientation.Hunicode-tricksThe object that is oriented.Iunicode-tricks$The oriented of the oriented object.Junicode-tricksThe possible orientations of a unicode character, these can be  horizontal, or vertical.Kunicode-tricks Horizontal orientation.Lunicode-tricksVertical orientation.Municode-tricks+Specify whether we write a positive number with or without a plus sign. the  is N.Nunicode-tricksWrite positive numbers without using a plus sign.Ounicode-tricksWrite positive numbers with a plus sign.Punicode-tricks$Specify whether we write a value in Q or R. The  is Q9, since for example often Roman numerals are written in  upper case.Qunicode-tricksThe  upper case formatting.Runicode-tricksThe  lower case formatting.Sunicode-tricks(Pick one of the two values based on the P value.Tunicode-tricks0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz satisfy this predicate.]unicode-tricks Checks if a charcter is a basic greek alphabetic3 character or a Greek-like symbol. The characters :DD satisfy this predicate.^unicode-tricks,Calculate for a given plus and minus sign a + object for the given number in the given M._unicode-tricks5A function to make it more convenient to implement a sign-value system. This is done for a given radix a function that maps the given value and the given weight to a  object, a  object for zero (since in some systems that is different), and characters for plus and minus&. The function then will for a given M convert the number to a sequence of characters with respect to how the sign-value system is implemented.`unicode-tricksA function to make it more convenient to implement a /positional number system. This is done for a given :radix/ a given conversion funtion that maps a value to a , and a  for plus and minus!. The function then construct a  object for a given M and a given number.aunicode-tricksA function to make it more convenient to implement a /positional number system with  radix/ 10.bunicode-tricks&Check if the given character is not a reserved character5. This is denoted in the Unicode documentation with  .cunicode-tricks"Check if the given character is a reserved character5. This is denoted in the Unicode documentation with  .dunicode-tricksCheck if the given character is a character according to the Unicode specifications. Codepoints that are not a character are denoted in the Unicode documentation with .eunicode-tricksCheck if the given character is not a character according to the Unicode specifications. The Unicode documentation denotes these with .funicode-tricksMap the given 9 object to an object with a type that is an instance of  with a given offset for the  acter range.gunicode-tricksMap the given 9 object to an object with a type that is an instance of . It first checks if the mapping results in a value between the  values for  and .hunicode-tricks8Map the given object with a type that is an instance of  to a "acter with a given offset for the  acter value.iunicode-tricksConstruct a function that maps digits to the character with the given value for the offset.junicode-tricksConstruct a function that maps digits to the character with the given value for the offset.kunicode-tricksConstruct a function that maps digits to the character with the given value for 0.lunicode-tricksConstruct a function that maps digits to characters with the given value for 0.municode-tricksConstruct a function that maps digits to the character with the given value for 0.nunicode-tricksConstruct a function that maps digits to characters with the given value for 0.ounicode-tricksConstruct a function that maps upper case alphabetic characters with the given value for A.punicode-tricksConstruct a function that maps upper case alphabetic characters with the given value for A.qunicode-tricksConstruct a function that maps lower case alphabetic characters with the given value for a.runicode-tricksConstruct a function that maps lower case alphabetic characters with the given value for a.sunicode-tricksConstruct a function that maps lower case alphabetic characters with the given values for A and a.tunicode-tricksConstruct a function that maps lower case alphabetic characters with the given values for A and a.#)unicode-tricks!The given object to convert to a  object.unicode-tricksA : object that is the Unicode representation of the element.*unicode-tricks The given  to convert to an object.unicode-tricks#The equivalent object wrapped in a  data constructor if it exists;  otherwise.+unicode-tricks The given  to convert to an object.unicode-tricksThe given equivalent object. If there is no equivalent object, the behavior is unspecified.-unicode-tricks!The given object to convert to a acter.unicode-tricksThe equivalent Unicode acter..unicode-tricks The given acter to convert to an element.unicode-tricksAn element if the given &acter maps to an element wrapped in a ;  otherwise./unicode-tricks The given acter to convert to an element.unicode-tricks2The given element that is equivalent to the given acter.Sunicode-tricksThe value to return in case of Q.unicode-tricksThe value to return in case of R.unicode-tricks The given  letter case.unicode-tricks.One of the two given values, depending on the P value.Tunicode-tricksThe value to return in case of N.unicode-tricksThe value to return in case of O.unicode-tricksThe plus style.unicode-tricks>One of the two given values, based on the 't:PlusStyle' value.Uunicode-tricksThe value to return in case of ;.unicode-tricksThe value to return in case of <.unicode-tricksThe emphasis type.unicode-tricks=One of the two given values, based on the 't:Emphasis' value.Vunicode-tricksThe value to return in case of 8.unicode-tricksThe value to return in case of 9.unicode-tricksThe italic type.unicode-tricks?One of the two given values, based on the 't:ItalicType' value.Wunicode-tricksThe value to return in case of 5.unicode-tricksThe value to return in case of 6.unicode-tricksThe font style.unicode-tricks>One of the two given values, based on the 't:FontStyle' value.Xunicode-tricks*The value to return in case of 'v:Ligate'.unicode-tricksThe value to return in case of 3.unicode-tricksThe ligation style.unicode-tricks;One of the two given values, based on the 't:Ligate' value.^unicode-tricks=The function that maps the absolute value of the number to a % object that is appended to the sign.unicode-tricksThe plus sign to use.unicode-tricksThe minus sign to use.unicode-tricks The given M to use.unicode-tricks The given  number to render.unicode-tricksA  object that represents the given number, with the given sign numbers in the given M._unicode-tricks The given radix to use.unicode-tricksA function that maps the value and the weight to a  object.unicode-tricks The given  used to represent zero.unicode-tricks The given  used to denote plus.unicode-tricks The given  used to denote minus.unicode-tricks The given M to use.unicode-tricksThe given number to convert.unicode-tricksA 5 object that denotes the given number with the given sign-value system.`unicode-tricksThe given radix to use.unicode-tricks$A function that maps the value of a digit to the corresponding .unicode-tricks#The given character used to denote plus.unicode-tricks#The given character used to denote minus.unicode-tricks The given M to use.unicode-tricksThe given number to convert.unicode-tricksA 5 object that denotes the given number with the given positional number system.aunicode-tricks$A function that maps the value of a digit to the corresponding .unicode-tricks#The given character used to denote plus.unicode-tricks#The given character used to denote minus.unicode-tricks The given M to use.unicode-tricksThe given number to convert.unicode-tricksA 5 object that denotes the given number with the given positional number system.bunicode-tricks The given acter to check.unicode-tricks if the given acter is not reserved;  otherwise.cunicode-tricks The given acter to check.unicode-tricks if the given acter is reserved;  otherwise.dunicode-tricks The given acter to check.unicode-tricks if the given acter is a character (according to the Unicode specifications);  otherwise.eunicode-tricks The given acter to check.unicode-tricks if the given acter is not a character (according to the Unicode specifications);  otherwise.funicode-tricks The given offset value.unicode-tricksThe acter to map to an  object.unicode-tricks The given  object for the given .gunicode-tricks The given offset value.unicode-tricks The given acter to map to an  object.unicode-tricks The given  object for the given acter wrapped in a  if that exists;  otherwise.hunicode-tricks The given offset value.unicode-tricks The given  value to convert to a acter.unicode-tricks,The character that corresponds to the given  object.iunicode-tricksThe given offset value.unicode-tricks%The maximum value that can be mapped.unicode-tricks,The given Unicode value used for the offset.unicode-tricksThe given number to convert, must be between the offset and the maximum.unicode-tricksThe corresponding acter wrapped in a 6 if the number is between the offset and the maximum;  otherwise.junicode-tricksThe given offset value.unicode-tricks,The given Unicode value used for the offset.unicode-tricks/The given number to convert to a corresponding acter.unicode-tricksThe corresponding %acter for the given mapping function.kunicode-tricks%The maximum value that can be mapped.unicode-tricks!The given Unicode value used for 0.unicode-tricksThe given digit to convert to a number between 0 and the maximum.unicode-tricksThe corresponding acter wrapped in a  if the number is between 0 and 9;  otherwise.lunicode-tricks"The given Unicode value used for 0.unicode-tricksThe given digit to convert.unicode-tricksThe corresponding acter, for numbers outside the 0-9" range, the result is unspecified.municode-tricks!The given Unicode value used for 0.unicode-tricks7The given digit to convert to a number between 0 and 9.unicode-tricksThe corresponding acter wrapped in a  if the number is between 0 and 9;  otherwise.nunicode-tricks"The given Unicode value used for 0.unicode-tricks,The given digit to convert, must be between 0 and 9.unicode-tricksThe corresponding acter, for numbers outside the 0-9" range, the result is unspecified.ounicode-tricksThe given Unicode value for A.unicode-tricksThe given character to convert.unicode-tricks)The corresponding character wrapped in a " if the given character is in the A-Z range;  otherwise.punicode-tricksThe given Unicode value for A.unicode-tricks1The given upper case alphabetic value to convert.unicode-tricks?The corresponding character, if the given value is outside the A-Z" range, the result is unspecified.qunicode-tricksThe given Unicode value for a.unicode-tricksThe given character to convert.unicode-tricks)The corresponding character wrapped in a " if the given character is in the a-z range;  otherwise.runicode-tricksThe given Unicode value for a.unicode-tricks1The given upper case alphabetic value to convert.unicode-tricks?The corresponding character, if the given value is outside the a-z" range, the result is unspecified.sunicode-tricksThe given Unicode value for A.unicode-tricksThe given Unicode value for a.unicode-tricksThe given character to convert.unicode-tricks)The corresponding character wrapped in a " if the given character is in the A-Z,a-z range;  otherwise.tunicode-tricksThe given Unicode value for A.unicode-tricksThe given Unicode value for a.unicode-tricksThe given character to convert.unicode-tricks=The corresponding character if the given character is in the A-Z,a-z range; unspecified otherwise.()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstJKLABCDEFGHI=>?@PQRS123XYZ:;p2 unicode-tricksA typeclass used to apply a  or a  to a , and return a  object.unicode-tricksApplies the given  or  to the given character. The operator is right-to-left, to allow "stacking" of s for example: 5'a' *^ CombiningGraveAccent *^ CombiningPlusSignBelowunicode-tricksApplies the given  or  to the given character, and use composition characters in case that is possible. The operator is right-to-left, to allow "stacking" of s for example: 7'a' *^! CombiningGraveAccent *^! CombiningPlusSignBelowunicode-tricks A set of ;s that can then all be applied to the same character. The * is used both to "stack" characters in a , and to apply a  or a  to a .unicode-tricks$A type synonym to make working with  more convenient.unicode-tricksThe list of possible combining characters. In the documentation of the combining characters, the characters are demonstrated on the bullet symbol (@).unicode-tricksThe combining character COMBINING GRAVE ACCENT' from the Unicode standard, defined by '\x0300' (@).unicode-tricksThe combining character COMBINING ACUTE ACCENT' from the Unicode standard, defined by '\x0301' (@).unicode-tricksThe combining character COMBINING CIRCUMFLEX ACCENT' from the Unicode standard, defined by '\x0302' (@).unicode-tricksThe combining character COMBINING TILDE' from the Unicode standard, defined by '\x0303' (@).unicode-tricksThe combining character COMBINING MACRON' from the Unicode standard, defined by '\x0304' (@).unicode-tricksThe combining character COMBINING OVERLINE' from the Unicode standard, defined by '\x0305' (@).unicode-tricksThe combining character COMBINING BREVE' from the Unicode standard, defined by '\x0306' (@).unicode-tricksThe combining character COMBINING DOT ABOVE' from the Unicode standard, defined by '\x0307' (@).unicode-tricksThe combining character COMBINING DIAERESIS' from the Unicode standard, defined by '\x0308' (@).unicode-tricksThe combining character COMBINING HOOK ABOVE' from the Unicode standard, defined by '\x0309' (@).unicode-tricksThe combining character COMBINING RING ABOVE' from the Unicode standard, defined by '\x030a' (@).unicode-tricksThe combining character COMBINING DOUBLE ACUTE ACCENT' from the Unicode standard, defined by '\x030b' (@).unicode-tricksThe combining character COMBINING CARON' from the Unicode standard, defined by '\x030c' (@).unicode-tricksThe combining character COMBINING VERTICAL LINE ABOVE' from the Unicode standard, defined by '\x030d' (@).unicode-tricksThe combining character $COMBINING DOUBLE VERTICAL LINE ABOVE' from the Unicode standard, defined by '\x030e' (@).unicode-tricksThe combining character COMBINING DOUBLE GRAVE ACCENT' from the Unicode standard, defined by '\x030f' (@).unicode-tricksThe combining character COMBINING CANDRABINDU' from the Unicode standard, defined by '\x0310' (@).unicode-tricksThe combining character COMBINING INVERTED BREVE' from the Unicode standard, defined by '\x0311' (@).unicode-tricksThe combining character COMBINING TURNED COMMA ABOVE' from the Unicode standard, defined by '\x0312' (@).unicode-tricksThe combining character COMBINING COMMA ABOVE' from the Unicode standard, defined by '\x0313' (@).unicode-tricksThe combining character COMBINING REVERSED COMMA ABOVE' from the Unicode standard, defined by '\x0314' (@).unicode-tricksThe combining character COMBINING COMMA ABOVE RIGHT' from the Unicode standard, defined by '\x0315' (@).unicode-tricksThe combining character COMBINING GRAVE ACCENT BELOW' from the Unicode standard, defined by '\x0316' (@).unicode-tricksThe combining character COMBINING ACUTE ACCENT BELOW' from the Unicode standard, defined by '\x0317' (@).unicode-tricksThe combining character COMBINING LEFT TACK BELOW' from the Unicode standard, defined by '\x0318' (@).unicode-tricksThe combining character COMBINING RIGHT TACK BELOW' from the Unicode standard, defined by '\x0319' (@).unicode-tricksThe combining character COMBINING LEFT ANGLE ABOVE' from the Unicode standard, defined by '\x031a' (@).unicode-tricksThe combining character COMBINING HORN' from the Unicode standard, defined by '\x031b' (@).unicode-tricksThe combining character COMBINING LEFT HALF RING BELOW' from the Unicode standard, defined by '\x031c' (@).unicode-tricksThe combining character COMBINING UP TACK BELOW' from the Unicode standard, defined by '\x031d' (@).unicode-tricksThe combining character COMBINING DOWN TACK BELOW' from the Unicode standard, defined by '\x031e' (@).unicode-tricksThe combining character COMBINING PLUS SIGN BELOW' from the Unicode standard, defined by '\x031f' (@).unicode-tricksThe combining character COMBINING MINUS SIGN BELOW' from the Unicode standard, defined by '\x0320' (@).unicode-tricksThe combining character  COMBINING PALATALIZED HOOK BELOW' from the Unicode standard, defined by '\x0321' (@).unicode-tricksThe combining character COMBINING RETROFLEX HOOK BELOW' from the Unicode standard, defined by '\x0322' (@).unicode-tricksThe combining character COMBINING DOT BELOW' from the Unicode standard, defined by '\x0323' (@).unicode-tricksThe combining character COMBINING DIAERESIS BELOW' from the Unicode standard, defined by '\x0324' (@).unicode-tricksThe combining character COMBINING RING BELOW' from the Unicode standard, defined by '\x0325' (@).unicode-tricksThe combining character COMBINING COMMA BELOW' from the Unicode standard, defined by '\x0326' (@).unicode-tricksThe combining character COMBINING CEDILLA' from the Unicode standard, defined by '\x0327' (@).unicode-tricksThe combining character COMBINING OGONEK' from the Unicode standard, defined by '\x0328' (@).unicode-tricksThe combining character COMBINING VERTICAL LINE BELOW' from the Unicode standard, defined by '\x0329' (@).unicode-tricksThe combining character COMBINING BRIDGE BELOW' from the Unicode standard, defined by '\x032a' (@).unicode-tricksThe combining character $COMBINING INVERTED DOUBLE ARCH BELOW' from the Unicode standard, defined by '\x032b' (@).unicode-tricksThe combining character COMBINING CARON BELOW' from the Unicode standard, defined by '\x032c' (@).unicode-tricksThe combining character !COMBINING CIRCUMFLEX ACCENT BELOW' from the Unicode standard, defined by '\x032d' (@).unicode-tricksThe combining character COMBINING BREVE BELOW' from the Unicode standard, defined by '\x032e' (@).unicode-tricksThe combining character COMBINING INVERTED BREVE BELOW' from the Unicode standard, defined by '\x032f' (@).unicode-tricksThe combining character COMBINING TILDE BELOW' from the Unicode standard, defined by '\x0330' (@).unicode-tricksThe combining character COMBINING MACRON BELOW' from the Unicode standard, defined by '\x0331' (@).unicode-tricksThe combining character COMBINING LOW LINE' from the Unicode standard, defined by '\x0332' (@).unicode-tricksThe combining character COMBINING DOUBLE LOW LINE' from the Unicode standard, defined by '\x0333' (@).unicode-tricksThe combining character COMBINING TILDE OVERLAY' from the Unicode standard, defined by '\x0334' (@).unicode-tricksThe combining character COMBINING SHORT STROKE OVERLAY' from the Unicode standard, defined by '\x0335' (@).unicode-tricksThe combining character COMBINING LONG STROKE OVERLAY' from the Unicode standard, defined by '\x0336' (@).unicode-tricksThe combining character COMBINING SHORT SOLIDUS OVERLAY' from the Unicode standard, defined by '\x0337' (@).unicode-tricksThe combining character COMBINING LONG SOLIDUS OVERLAY' from the Unicode standard, defined by '\x0338' (@).unicode-tricksThe combining character COMBINING RIGHT HALF RING BELOW' from the Unicode standard, defined by '\x0339' (@).unicode-tricksThe combining character COMBINING INVERTED BRIDGE BELOW' from the Unicode standard, defined by '\x033a' (@).unicode-tricksThe combining character COMBINING SQUARE BELOW' from the Unicode standard, defined by '\x033b' (@).unicode-tricksThe combining character COMBINING SEAGULL BELOW' from the Unicode standard, defined by '\x033c' (@).unicode-tricksThe combining character COMBINING X ABOVE' from the Unicode standard, defined by '\x033d' (@).unicode-tricksThe combining character COMBINING VERTICAL TILDE' from the Unicode standard, defined by '\x033e' (@).unicode-tricksThe combining character COMBINING DOUBLE OVERLINE' from the Unicode standard, defined by '\x033f' (@).unicode-tricksThe combining character COMBINING GRAVE TONE MARK' from the Unicode standard, defined by '\x0340' (@).unicode-tricksThe combining character COMBINING ACUTE TONE MARK' from the Unicode standard, defined by '\x0341' (@).unicode-tricksThe combining character COMBINING GREEK PERISPOMENI' from the Unicode standard, defined by '\x0342' (@).unicode-tricksThe combining character COMBINING GREEK KORONIS' from the Unicode standard, defined by '\x0343' (@).unicode-tricksThe combining character COMBINING GREEK DIALYTIKA TONOS' from the Unicode standard, defined by '\x0344' (@).unicode-tricksThe combining character COMBINING GREEK YPOGEGRAMMENI' from the Unicode standard, defined by '\x0345' (@).unicode-tricksThe combining character COMBINING BRIDGE ABOVE' from the Unicode standard, defined by '\x0346' (@).unicode-tricksThe combining character COMBINING EQUALS SIGN BELOW' from the Unicode standard, defined by '\x0347' (@).unicode-tricksThe combining character $COMBINING DOUBLE VERTICAL LINE BELOW' from the Unicode standard, defined by '\x0348' (@).unicode-tricksThe combining character COMBINING LEFT ANGLE BELOW' from the Unicode standard, defined by '\x0349' (@).unicode-tricksThe combining character COMBINING NOT TILDE ABOVE' from the Unicode standard, defined by '\x034a' (@).unicode-tricksThe combining character COMBINING HOMOTHETIC ABOVE' from the Unicode standard, defined by '\x034b' (@).unicode-tricksThe combining character COMBINING ALMOST EQUAL TO ABOVE' from the Unicode standard, defined by '\x034c' (@).unicode-tricksThe combining character  COMBINING LEFT RIGHT ARROW BELOW' from the Unicode standard, defined by '\x034d' (@).unicode-tricksThe combining character COMBINING UPWARDS ARROW BELOW' from the Unicode standard, defined by '\x034e' (@).unicode-tricksThe combining character COMBINING RIGHT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x0350' (@).unicode-tricksThe combining character COMBINING LEFT HALF RING ABOVE' from the Unicode standard, defined by '\x0351' (@).unicode-tricksThe combining character COMBINING FERMATA' from the Unicode standard, defined by '\x0352' (@).unicode-tricksThe combining character COMBINING X BELOW' from the Unicode standard, defined by '\x0353' (@).unicode-tricksThe combining character COMBINING LEFT ARROWHEAD BELOW' from the Unicode standard, defined by '\x0354' (@).unicode-tricksThe combining character COMBINING RIGHT ARROWHEAD BELOW' from the Unicode standard, defined by '\x0355' (@).unicode-tricksThe combining character 0COMBINING RIGHT ARROWHEAD AND UP ARROWHEAD BELOW' from the Unicode standard, defined by '\x0356' (@).unicode-tricksThe combining character COMBINING RIGHT HALF RING ABOVE' from the Unicode standard, defined by '\x0357' (@).unicode-tricksThe combining character COMBINING DOT ABOVE RIGHT' from the Unicode standard, defined by '\x0358' (@).unicode-tricksThe combining character COMBINING ASTERISK BELOW' from the Unicode standard, defined by '\x0359' (@).unicode-tricksThe combining character COMBINING DOUBLE RING BELOW' from the Unicode standard, defined by '\x035a' (@).unicode-tricksThe combining character COMBINING ZIGZAG ABOVE' from the Unicode standard, defined by '\x035b' (@).unicode-tricksThe combining character COMBINING DOUBLE BREVE BELOW' from the Unicode standard, defined by '\x035c' (@).unicode-tricksThe combining character COMBINING DOUBLE BREVE' from the Unicode standard, defined by '\x035d' (@).unicode-tricksThe combining character COMBINING DOUBLE MACRON' from the Unicode standard, defined by '\x035e' (@).unicode-tricksThe combining character COMBINING DOUBLE MACRON BELOW' from the Unicode standard, defined by '\x035f' (@).unicode-tricksThe combining character COMBINING DOUBLE TILDE' from the Unicode standard, defined by '\x0360' (@).unicode-tricksThe combining character COMBINING DOUBLE INVERTED BREVE' from the Unicode standard, defined by '\x0361' (@).unicode-tricksThe combining character 'COMBINING DOUBLE RIGHTWARDS ARROW BELOW' from the Unicode standard, defined by '\x0362' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER A' from the Unicode standard, defined by '\x0363' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER E' from the Unicode standard, defined by '\x0364' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER I' from the Unicode standard, defined by '\x0365' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER O' from the Unicode standard, defined by '\x0366' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER U' from the Unicode standard, defined by '\x0367' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER C' from the Unicode standard, defined by '\x0368' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER D' from the Unicode standard, defined by '\x0369' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER H' from the Unicode standard, defined by '\x036a' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER M' from the Unicode standard, defined by '\x036b' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER R' from the Unicode standard, defined by '\x036c' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER T' from the Unicode standard, defined by '\x036d' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER V' from the Unicode standard, defined by '\x036e' (@).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER X' from the Unicode standard, defined by '\x036f' (@).unicode-tricksThe combining character COMBINING CYRILLIC TITLO' from the Unicode standard, defined by '\x0483' (@ ).unicode-tricksThe combining character !COMBINING CYRILLIC PALATALIZATION' from the Unicode standard, defined by '\x0484' (@ ).unicode-tricksThe combining character !COMBINING CYRILLIC DASIA PNEUMATA' from the Unicode standard, defined by '\x0485' (@ ).unicode-tricksThe combining character !COMBINING CYRILLIC PSILI PNEUMATA' from the Unicode standard, defined by '\x0486' (@ ).unicode-tricksThe combining character COMBINING CYRILLIC POKRYTIE' from the Unicode standard, defined by '\x0487' (@ ).unicode-tricksThe combining character HEBREW ACCENT ETNAHTA' from the Unicode standard, defined by '\x0591' (@ ).unicode-tricksThe combining character HEBREW ACCENT SEGOL' from the Unicode standard, defined by '\x0592' (@ ).unicode-tricksThe combining character HEBREW ACCENT SHALSHELET' from the Unicode standard, defined by '\x0593' (@ ).unicode-tricksThe combining character HEBREW ACCENT ZAQEF QATAN' from the Unicode standard, defined by '\x0594' (@ ).unicode-tricksThe combining character HEBREW ACCENT ZAQEF GADOL' from the Unicode standard, defined by '\x0595' (@ ).unicode-tricksThe combining character HEBREW ACCENT TIPEHA' from the Unicode standard, defined by '\x0596' (@ ).unicode-tricksThe combining character HEBREW ACCENT REVIA' from the Unicode standard, defined by '\x0597' (@ ).unicode-tricksThe combining character HEBREW ACCENT ZARQA' from the Unicode standard, defined by '\x0598' (@ ).unicode-tricksThe combining character HEBREW ACCENT PASHTA' from the Unicode standard, defined by '\x0599' (@ ).unicode-tricksThe combining character HEBREW ACCENT YETIV' from the Unicode standard, defined by '\x059a' (@ ).unicode-tricksThe combining character HEBREW ACCENT TEVIR' from the Unicode standard, defined by '\x059b' (@ ).unicode-tricksThe combining character HEBREW ACCENT GERESH' from the Unicode standard, defined by '\x059c' (@ ).unicode-tricksThe combining character HEBREW ACCENT GERESH MUQDAM' from the Unicode standard, defined by '\x059d' (@ ).unicode-tricksThe combining character HEBREW ACCENT GERSHAYIM' from the Unicode standard, defined by '\x059e' (@ ).unicode-tricksThe combining character HEBREW ACCENT QARNEY PARA' from the Unicode standard, defined by '\x059f' (@ ).unicode-tricksThe combining character HEBREW ACCENT TELISHA GEDOLA' from the Unicode standard, defined by '\x05a0' (@ ).unicode-tricksThe combining character HEBREW ACCENT PAZER' from the Unicode standard, defined by '\x05a1' (@ ).unicode-tricksThe combining character HEBREW ACCENT ATNAH HAFUKH' from the Unicode standard, defined by '\x05a2' (@ ).unicode-tricksThe combining character HEBREW ACCENT MUNAH' from the Unicode standard, defined by '\x05a3' (@ ).unicode-tricksThe combining character HEBREW ACCENT MAHAPAKH' from the Unicode standard, defined by '\x05a4' (@ ).unicode-tricksThe combining character HEBREW ACCENT MERKHA' from the Unicode standard, defined by '\x05a5' (@ ).unicode-tricksThe combining character HEBREW ACCENT MERKHA KEFULA' from the Unicode standard, defined by '\x05a6' (@ ).unicode-tricksThe combining character HEBREW ACCENT DARGA' from the Unicode standard, defined by '\x05a7' (@ ).unicode-tricksThe combining character HEBREW ACCENT QADMA' from the Unicode standard, defined by '\x05a8' (@ ).unicode-tricksThe combining character HEBREW ACCENT TELISHA QETANA' from the Unicode standard, defined by '\x05a9' (@ ).unicode-tricksThe combining character HEBREW ACCENT YERAH BEN YOMO' from the Unicode standard, defined by '\x05aa' (@ ).unicode-tricksThe combining character HEBREW ACCENT OLE' from the Unicode standard, defined by '\x05ab' (@ ).unicode-tricksThe combining character HEBREW ACCENT ILUY' from the Unicode standard, defined by '\x05ac' (@ ).unicode-tricksThe combining character HEBREW ACCENT DEHI' from the Unicode standard, defined by '\x05ad' (@ ).unicode-tricksThe combining character HEBREW ACCENT ZINOR' from the Unicode standard, defined by '\x05ae' (@ ).unicode-tricksThe combining character HEBREW MARK MASORA CIRCLE' from the Unicode standard, defined by '\x05af' (@ ).unicode-tricksThe combining character HEBREW POINT SHEVA' from the Unicode standard, defined by '\x05b0' (@ ).unicode-tricksThe combining character HEBREW POINT HATAF SEGOL' from the Unicode standard, defined by '\x05b1' (@ ).unicode-tricksThe combining character HEBREW POINT HATAF PATAH' from the Unicode standard, defined by '\x05b2' (@ ).unicode-tricksThe combining character HEBREW POINT HATAF QAMATS' from the Unicode standard, defined by '\x05b3' (@ ).unicode-tricksThe combining character HEBREW POINT HIRIQ' from the Unicode standard, defined by '\x05b4' (@ ).unicode-tricksThe combining character HEBREW POINT TSERE' from the Unicode standard, defined by '\x05b5' (@ ).unicode-tricksThe combining character HEBREW POINT SEGOL' from the Unicode standard, defined by '\x05b6' (@ ).unicode-tricksThe combining character HEBREW POINT PATAH' from the Unicode standard, defined by '\x05b7' (@ ).unicode-tricksThe combining character HEBREW POINT QAMATS' from the Unicode standard, defined by '\x05b8' (@ ).unicode-tricksThe combining character HEBREW POINT HOLAM' from the Unicode standard, defined by '\x05b9' (@ ).unicode-tricksThe combining character  HEBREW POINT HOLAM HASER FOR VAV' from the Unicode standard, defined by '\x05ba' (@ ).unicode-tricksThe combining character HEBREW POINT QUBUTS' from the Unicode standard, defined by '\x05bb' (@ ).unicode-tricksThe combining character HEBREW POINT DAGESH OR MAPIQ' from the Unicode standard, defined by '\x05bc' (@ ).unicode-tricksThe combining character HEBREW POINT METEG' from the Unicode standard, defined by '\x05bd' (@ ).unicode-tricksThe combining character HEBREW POINT RAFE' from the Unicode standard, defined by '\x05bf' (@ ).unicode-tricksThe combining character HEBREW POINT SHIN DOT' from the Unicode standard, defined by '\x05c1' (@ ).unicode-tricksThe combining character HEBREW POINT SIN DOT' from the Unicode standard, defined by '\x05c2' (@ ).unicode-tricksThe combining character HEBREW MARK UPPER DOT' from the Unicode standard, defined by '\x05c4' (@ ).unicode-tricksThe combining character HEBREW MARK LOWER DOT' from the Unicode standard, defined by '\x05c5' (@ ).unicode-tricksThe combining character HEBREW POINT QAMATS QATAN' from the Unicode standard, defined by '\x05c7' (@ ).unicode-tricksThe combining character (ARABIC SIGN SALLALLAHOU ALAYHE WASSALLAM' from the Unicode standard, defined by '\x0610' (@ ).unicode-tricksThe combining character ARABIC SIGN ALAYHE ASSALLAM' from the Unicode standard, defined by '\x0611' (@ ).unicode-tricksThe combining character ARABIC SIGN RAHMATULLAH ALAYHE' from the Unicode standard, defined by '\x0612' (@ ).unicode-tricksThe combining character ARABIC SIGN RADI ALLAHOU ANHU' from the Unicode standard, defined by '\x0613' (@ ).unicode-tricksThe combining character ARABIC SIGN TAKHALLUS' from the Unicode standard, defined by '\x0614' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH TAH' from the Unicode standard, defined by '\x0615' (@ ).unicode-tricksThe combining character 1ARABIC SMALL HIGH LIGATURE ALEF WITH LAM WITH YEH' from the Unicode standard, defined by '\x0616' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH ZAIN' from the Unicode standard, defined by '\x0617' (@ ).unicode-tricksThe combining character ARABIC SMALL FATHA' from the Unicode standard, defined by '\x0618' (@ ).unicode-tricksThe combining character ARABIC SMALL DAMMA' from the Unicode standard, defined by '\x0619' (@ ).unicode-tricksThe combining character ARABIC SMALL KASRA' from the Unicode standard, defined by '\x061a' (@ ).unicode-tricksThe combining character ARABIC FATHATAN' from the Unicode standard, defined by '\x064b' (@ ).unicode-tricksThe combining character ARABIC DAMMATAN' from the Unicode standard, defined by '\x064c' (@ ).unicode-tricksThe combining character ARABIC KASRATAN' from the Unicode standard, defined by '\x064d' (@ ).unicode-tricksThe combining character  ARABIC FATHA' from the Unicode standard, defined by '\x064e' (@ ).unicode-tricksThe combining character  ARABIC DAMMA' from the Unicode standard, defined by '\x064f' (@ ).unicode-tricksThe combining character  ARABIC KASRA' from the Unicode standard, defined by '\x0650' (@ ).unicode-tricksThe combining character  ARABIC SHADDA' from the Unicode standard, defined by '\x0651' (@ ).unicode-tricksThe combining character  ARABIC SUKUN' from the Unicode standard, defined by '\x0652' (@ ).unicode-tricksThe combining character ARABIC MADDAH ABOVE' from the Unicode standard, defined by '\x0653' (@ ).unicode-tricksThe combining character ARABIC HAMZA ABOVE' from the Unicode standard, defined by '\x0654' (@ ).unicode-tricksThe combining character ARABIC HAMZA BELOW' from the Unicode standard, defined by '\x0655' (@ ).unicode-tricksThe combining character ARABIC SUBSCRIPT ALEF' from the Unicode standard, defined by '\x0656' (@ ).unicode-tricksThe combining character ARABIC INVERTED DAMMA' from the Unicode standard, defined by '\x0657' (@ ).unicode-tricksThe combining character ARABIC MARK NOON GHUNNA' from the Unicode standard, defined by '\x0658' (@ ).unicode-tricksThe combining character ARABIC ZWARAKAY' from the Unicode standard, defined by '\x0659' (@ ).unicode-tricksThe combining character ARABIC VOWEL SIGN SMALL V ABOVE' from the Unicode standard, defined by '\x065a' (@ ).unicode-tricksThe combining character (ARABIC VOWEL SIGN INVERTED SMALL V ABOVE' from the Unicode standard, defined by '\x065b' (@ ).unicode-tricksThe combining character ARABIC VOWEL SIGN DOT BELOW' from the Unicode standard, defined by '\x065c' (@ ).unicode-tricksThe combining character ARABIC REVERSED DAMMA' from the Unicode standard, defined by '\x065d' (@ ).unicode-tricksThe combining character ARABIC FATHA WITH TWO DOTS' from the Unicode standard, defined by '\x065e' (@ ).unicode-tricksThe combining character ARABIC WAVY HAMZA BELOW' from the Unicode standard, defined by '\x065f' (@ ).unicode-tricksThe combining character ARABIC LETTER SUPERSCRIPT ALEF' from the Unicode standard, defined by '\x0670' (@ ).unicode-tricksThe combining character 9ARABIC SMALL HIGH LIGATURE SAD WITH LAM WITH ALEF MAKSURA' from the Unicode standard, defined by '\x06d6' (@ ).unicode-tricksThe combining character 9ARABIC SMALL HIGH LIGATURE QAF WITH LAM WITH ALEF MAKSURA' from the Unicode standard, defined by '\x06d7' (@ ).unicode-tricksThe combining character #ARABIC SMALL HIGH MEEM INITIAL FORM' from the Unicode standard, defined by '\x06d8' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH LAM ALEF' from the Unicode standard, defined by '\x06d9' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH JEEM' from the Unicode standard, defined by '\x06da' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH THREE DOTS' from the Unicode standard, defined by '\x06db' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH SEEN' from the Unicode standard, defined by '\x06dc' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH ROUNDED ZERO' from the Unicode standard, defined by '\x06df' (@ ).unicode-tricksThe combining character *ARABIC SMALL HIGH UPRIGHT RECTANGULAR ZERO' from the Unicode standard, defined by '\x06e0' (@ ).unicode-tricksThe combining character &ARABIC SMALL HIGH DOTLESS HEAD OF KHAH' from the Unicode standard, defined by '\x06e1' (@ ).unicode-tricksThe combining character $ARABIC SMALL HIGH MEEM ISOLATED FORM' from the Unicode standard, defined by '\x06e2' (@ ).unicode-tricksThe combining character ARABIC SMALL LOW SEEN' from the Unicode standard, defined by '\x06e3' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH MADDA' from the Unicode standard, defined by '\x06e4' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH YEH' from the Unicode standard, defined by '\x06e7' (@ ).unicode-tricksThe combining character ARABIC SMALL HIGH NOON' from the Unicode standard, defined by '\x06e8' (@ ).unicode-tricksThe combining character ARABIC EMPTY CENTRE LOW STOP' from the Unicode standard, defined by '\x06ea' (@ ).unicode-tricksThe combining character ARABIC EMPTY CENTRE HIGH STOP' from the Unicode standard, defined by '\x06eb' (@ ).unicode-tricksThe combining character +ARABIC ROUNDED HIGH STOP WITH FILLED CENTRE' from the Unicode standard, defined by '\x06ec' (@ ).unicode-tricksThe combining character ARABIC SMALL LOW MEEM' from the Unicode standard, defined by '\x06ed' (@ ).unicode-tricksThe combining character SYRIAC LETTER SUPERSCRIPT ALAPH' from the Unicode standard, defined by '\x0711' (@).unicode-tricksThe combining character SYRIAC PTHAHA ABOVE' from the Unicode standard, defined by '\x0730' (@).unicode-tricksThe combining character SYRIAC PTHAHA BELOW' from the Unicode standard, defined by '\x0731' (@).unicode-tricksThe combining character SYRIAC PTHAHA DOTTED' from the Unicode standard, defined by '\x0732' (@).unicode-tricksThe combining character SYRIAC ZQAPHA ABOVE' from the Unicode standard, defined by '\x0733' (@).unicode-tricksThe combining character SYRIAC ZQAPHA BELOW' from the Unicode standard, defined by '\x0734' (@).unicode-tricksThe combining character SYRIAC ZQAPHA DOTTED' from the Unicode standard, defined by '\x0735' (@).unicode-tricksThe combining character SYRIAC RBASA ABOVE' from the Unicode standard, defined by '\x0736' (@).unicode-tricksThe combining character SYRIAC RBASA BELOW' from the Unicode standard, defined by '\x0737' (@).unicode-tricksThe combining character SYRIAC DOTTED ZLAMA HORIZONTAL' from the Unicode standard, defined by '\x0738' (@).unicode-tricksThe combining character SYRIAC DOTTED ZLAMA ANGULAR' from the Unicode standard, defined by '\x0739' (@).unicode-tricksThe combining character SYRIAC HBASA ABOVE' from the Unicode standard, defined by '\x073a' (@).unicode-tricksThe combining character SYRIAC HBASA BELOW' from the Unicode standard, defined by '\x073b' (@).unicode-tricksThe combining character SYRIAC HBASA-ESASA DOTTED' from the Unicode standard, defined by '\x073c' (@).unicode-tricksThe combining character SYRIAC ESASA ABOVE' from the Unicode standard, defined by '\x073d' (@).unicode-tricksThe combining character SYRIAC ESASA BELOW' from the Unicode standard, defined by '\x073e' (@).unicode-tricksThe combining character  SYRIAC RWAHA' from the Unicode standard, defined by '\x073f' (@).unicode-tricksThe combining character SYRIAC FEMININE DOT' from the Unicode standard, defined by '\x0740' (@).unicode-tricksThe combining character SYRIAC QUSHSHAYA' from the Unicode standard, defined by '\x0741' (@).unicode-tricksThe combining character SYRIAC RUKKAKHA' from the Unicode standard, defined by '\x0742' (@).unicode-tricksThe combining character SYRIAC TWO VERTICAL DOTS ABOVE' from the Unicode standard, defined by '\x0743' (@).unicode-tricksThe combining character SYRIAC TWO VERTICAL DOTS BELOW' from the Unicode standard, defined by '\x0744' (@).unicode-tricksThe combining character SYRIAC THREE DOTS ABOVE' from the Unicode standard, defined by '\x0745' (@).unicode-tricksThe combining character SYRIAC THREE DOTS BELOW' from the Unicode standard, defined by '\x0746' (@).unicode-tricksThe combining character SYRIAC OBLIQUE LINE ABOVE' from the Unicode standard, defined by '\x0747' (@).unicode-tricksThe combining character SYRIAC OBLIQUE LINE BELOW' from the Unicode standard, defined by '\x0748' (@).unicode-tricksThe combining character  SYRIAC MUSIC' from the Unicode standard, defined by '\x0749' (@).unicode-tricksThe combining character SYRIAC BARREKH' from the Unicode standard, defined by '\x074a' (@).unicode-tricksThe combining character NKO COMBINING SHORT HIGH TONE' from the Unicode standard, defined by '\x07eb' (@).unicode-tricksThe combining character NKO COMBINING SHORT LOW TONE' from the Unicode standard, defined by '\x07ec' (@).unicode-tricksThe combining character NKO COMBINING SHORT RISING TONE' from the Unicode standard, defined by '\x07ed' (@).unicode-tricksThe combining character "NKO COMBINING LONG DESCENDING TONE' from the Unicode standard, defined by '\x07ee' (@).unicode-tricksThe combining character NKO COMBINING LONG HIGH TONE' from the Unicode standard, defined by '\x07ef' (@).unicode-tricksThe combining character NKO COMBINING LONG LOW TONE' from the Unicode standard, defined by '\x07f0' (@).unicode-tricksThe combining character NKO COMBINING LONG RISING TONE' from the Unicode standard, defined by '\x07f1' (@).unicode-tricksThe combining character NKO COMBINING NASALIZATION MARK' from the Unicode standard, defined by '\x07f2' (@).unicode-tricksThe combining character NKO COMBINING DOUBLE DOT ABOVE' from the Unicode standard, defined by '\x07f3' (@).unicode-tricksThe combining character SAMARITAN MARK IN' from the Unicode standard, defined by '\x0816' (@).unicode-tricksThe combining character SAMARITAN MARK IN-ALAF' from the Unicode standard, defined by '\x0817' (@).unicode-tricksThe combining character SAMARITAN MARK OCCLUSION' from the Unicode standard, defined by '\x0818' (@).unicode-tricksThe combining character SAMARITAN MARK DAGESH' from the Unicode standard, defined by '\x0819' (@).unicode-tricksThe combining character SAMARITAN MARK EPENTHETIC YUT' from the Unicode standard, defined by '\x081b' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG E' from the Unicode standard, defined by '\x081c' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN E' from the Unicode standard, defined by '\x081d' (@).unicode-tricksThe combining character  SAMARITAN VOWEL SIGN OVERLONG AA' from the Unicode standard, defined by '\x081e' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG AA' from the Unicode standard, defined by '\x081f' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN AA' from the Unicode standard, defined by '\x0820' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN OVERLONG A' from the Unicode standard, defined by '\x0821' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG A' from the Unicode standard, defined by '\x0822' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN A' from the Unicode standard, defined by '\x0823' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN SHORT A' from the Unicode standard, defined by '\x0825' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG U' from the Unicode standard, defined by '\x0826' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN U' from the Unicode standard, defined by '\x0827' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG I' from the Unicode standard, defined by '\x0829' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN I' from the Unicode standard, defined by '\x082a' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN O' from the Unicode standard, defined by '\x082b' (@).unicode-tricksThe combining character SAMARITAN VOWEL SIGN SUKUN' from the Unicode standard, defined by '\x082c' (@).unicode-tricksThe combining character SAMARITAN MARK NEQUDAA' from the Unicode standard, defined by '\x082d' (@).unicode-tricksThe combining character MANDAIC AFFRICATION MARK' from the Unicode standard, defined by '\x0859' (@).unicode-tricksThe combining character MANDAIC VOCALIZATION MARK' from the Unicode standard, defined by '\x085a' (@).unicode-tricksThe combining character MANDAIC GEMINATION MARK' from the Unicode standard, defined by '\x085b' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WORD AR-RUB' from the Unicode standard, defined by '\x08d4' (@).unicode-tricksThe combining character ARABIC SMALL HIGH SAD' from the Unicode standard, defined by '\x08d5' (@).unicode-tricksThe combining character ARABIC SMALL HIGH AIN' from the Unicode standard, defined by '\x08d6' (@).unicode-tricksThe combining character ARABIC SMALL HIGH QAF' from the Unicode standard, defined by '\x08d7' (@).unicode-tricksThe combining character !ARABIC SMALL HIGH NOON WITH KASRA' from the Unicode standard, defined by '\x08d8' (@).unicode-tricksThe combining character  ARABIC SMALL LOW NOON WITH KASRA' from the Unicode standard, defined by '\x08d9' (@).unicode-tricksThe combining character #ARABIC SMALL HIGH WORD ATH-THALATHA' from the Unicode standard, defined by '\x08da' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WORD AS-SAJDA' from the Unicode standard, defined by '\x08db' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WORD AN-NISF' from the Unicode standard, defined by '\x08dc' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WORD SAKTA' from the Unicode standard, defined by '\x08dd' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WORD QIF' from the Unicode standard, defined by '\x08de' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WORD WAQFA' from the Unicode standard, defined by '\x08df' (@).unicode-tricksThe combining character !ARABIC SMALL HIGH FOOTNOTE MARKER' from the Unicode standard, defined by '\x08e0' (@).unicode-tricksThe combining character ARABIC SMALL HIGH SIGN SAFHA' from the Unicode standard, defined by '\x08e1' (@).unicode-tricksThe combining character ARABIC TURNED DAMMA BELOW' from the Unicode standard, defined by '\x08e3' (@).unicode-tricksThe combining character ARABIC CURLY FATHA' from the Unicode standard, defined by '\x08e4' (@).unicode-tricksThe combining character ARABIC CURLY DAMMA' from the Unicode standard, defined by '\x08e5' (@).unicode-tricksThe combining character ARABIC CURLY KASRA' from the Unicode standard, defined by '\x08e6' (@).unicode-tricksThe combining character ARABIC CURLY FATHATAN' from the Unicode standard, defined by '\x08e7' (@).unicode-tricksThe combining character ARABIC CURLY DAMMATAN' from the Unicode standard, defined by '\x08e8' (@).unicode-tricksThe combining character ARABIC CURLY KASRATAN' from the Unicode standard, defined by '\x08e9' (@).unicode-tricksThe combining character ARABIC TONE ONE DOT ABOVE' from the Unicode standard, defined by '\x08ea' (@).unicode-tricksThe combining character ARABIC TONE TWO DOTS ABOVE' from the Unicode standard, defined by '\x08eb' (@).unicode-tricksThe combining character ARABIC TONE LOOP ABOVE' from the Unicode standard, defined by '\x08ec' (@).unicode-tricksThe combining character ARABIC TONE ONE DOT BELOW' from the Unicode standard, defined by '\x08ed' (@).unicode-tricksThe combining character ARABIC TONE TWO DOTS BELOW' from the Unicode standard, defined by '\x08ee' (@).unicode-tricksThe combining character ARABIC TONE LOOP BELOW' from the Unicode standard, defined by '\x08ef' (@).unicode-tricksThe combining character ARABIC OPEN FATHATAN' from the Unicode standard, defined by '\x08f0' (@).unicode-tricksThe combining character ARABIC OPEN DAMMATAN' from the Unicode standard, defined by '\x08f1' (@).unicode-tricksThe combining character ARABIC OPEN KASRATAN' from the Unicode standard, defined by '\x08f2' (@).unicode-tricksThe combining character ARABIC SMALL HIGH WAW' from the Unicode standard, defined by '\x08f3' (@).unicode-tricksThe combining character ARABIC FATHA WITH RING' from the Unicode standard, defined by '\x08f4' (@).unicode-tricksThe combining character ARABIC FATHA WITH DOT ABOVE' from the Unicode standard, defined by '\x08f5' (@).unicode-tricksThe combining character ARABIC KASRA WITH DOT BELOW' from the Unicode standard, defined by '\x08f6' (@).unicode-tricksThe combining character ARABIC LEFT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x08f7' (@).unicode-tricksThe combining character ARABIC RIGHT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x08f8' (@).unicode-tricksThe combining character ARABIC LEFT ARROWHEAD BELOW' from the Unicode standard, defined by '\x08f9' (@).unicode-tricksThe combining character ARABIC RIGHT ARROWHEAD BELOW' from the Unicode standard, defined by '\x08fa' (@).unicode-tricksThe combining character #ARABIC DOUBLE RIGHT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x08fb' (@).unicode-tricksThe combining character ,ARABIC DOUBLE RIGHT ARROWHEAD ABOVE WITH DOT' from the Unicode standard, defined by '\x08fc' (@).unicode-tricksThe combining character %ARABIC RIGHT ARROWHEAD ABOVE WITH DOT' from the Unicode standard, defined by '\x08fd' (@).unicode-tricksThe combining character ARABIC DAMMA WITH DOT' from the Unicode standard, defined by '\x08fe' (@).unicode-tricksThe combining character  ARABIC MARK SIDEWAYS NOON GHUNNA' from the Unicode standard, defined by '\x08ff' (@).unicode-tricksThe combining character DEVANAGARI SIGN NUKTA' from the Unicode standard, defined by '\x093c' (@).unicode-tricksThe combining character DEVANAGARI SIGN VIRAMA' from the Unicode standard, defined by '\x094d' (@).unicode-tricksThe combining character DEVANAGARI STRESS SIGN UDATTA' from the Unicode standard, defined by '\x0951' (@).unicode-tricksThe combining character DEVANAGARI STRESS SIGN ANUDATTA' from the Unicode standard, defined by '\x0952' (@).unicode-tricksThe combining character DEVANAGARI GRAVE ACCENT' from the Unicode standard, defined by '\x0953' (@).unicode-tricksThe combining character DEVANAGARI ACUTE ACCENT' from the Unicode standard, defined by '\x0954' (@).unicode-tricksThe combining character BENGALI SIGN NUKTA' from the Unicode standard, defined by '\x09bc' (@).unicode-tricksThe combining character BENGALI VOWEL SIGN AA' from the Unicode standard, defined by '\x09be' (@).unicode-tricksThe combining character BENGALI SIGN VIRAMA' from the Unicode standard, defined by '\x09cd' (@).unicode-tricksThe combining character BENGALI AU LENGTH MARK' from the Unicode standard, defined by '\x09d7' (@).unicode-tricksThe combining character GURMUKHI SIGN NUKTA' from the Unicode standard, defined by '\x0a3c' (@).unicode-tricksThe combining character GURMUKHI SIGN VIRAMA' from the Unicode standard, defined by '\x0a4d' (@).unicode-tricksThe combining character GUJARATI SIGN NUKTA' from the Unicode standard, defined by '\x0abc' (@).unicode-tricksThe combining character GUJARATI SIGN VIRAMA' from the Unicode standard, defined by '\x0acd' (@).unicode-tricksThe combining character ORIYA SIGN NUKTA' from the Unicode standard, defined by '\x0b3c' (@).unicode-tricksThe combining character ORIYA VOWEL SIGN AA' from the Unicode standard, defined by '\x0b3e' (@).unicode-tricksThe combining character ORIYA SIGN VIRAMA' from the Unicode standard, defined by '\x0b4d' (@).unicode-tricksThe combining character ORIYA AI LENGTH MARK' from the Unicode standard, defined by '\x0b56' (@).unicode-tricksThe combining character ORIYA AU LENGTH MARK' from the Unicode standard, defined by '\x0b57' (@).unicode-tricksThe combining character TAMIL VOWEL SIGN AA' from the Unicode standard, defined by '\x0bbe' (@).unicode-tricksThe combining character TAMIL SIGN VIRAMA' from the Unicode standard, defined by '\x0bcd' (@).unicode-tricksThe combining character TAMIL AU LENGTH MARK' from the Unicode standard, defined by '\x0bd7' (@).unicode-tricksThe combining character TELUGU SIGN VIRAMA' from the Unicode standard, defined by '\x0c4d' (@).unicode-tricksThe combining character TELUGU LENGTH MARK' from the Unicode standard, defined by '\x0c55' (@).unicode-tricksThe combining character TELUGU AI LENGTH MARK' from the Unicode standard, defined by '\x0c56' (@).unicode-tricksThe combining character KANNADA SIGN NUKTA' from the Unicode standard, defined by '\x0cbc' (@).unicode-tricksThe combining character KANNADA VOWEL SIGN UU' from the Unicode standard, defined by '\x0cc2' (@).unicode-tricksThe combining character KANNADA SIGN VIRAMA' from the Unicode standard, defined by '\x0ccd' (@).unicode-tricksThe combining character KANNADA LENGTH MARK' from the Unicode standard, defined by '\x0cd5' (@).unicode-tricksThe combining character KANNADA AI LENGTH MARK' from the Unicode standard, defined by '\x0cd6' (@).unicode-tricksThe combining character MALAYALAM VOWEL SIGN AA' from the Unicode standard, defined by '\x0d3e' (@).unicode-tricksThe combining character MALAYALAM SIGN VIRAMA' from the Unicode standard, defined by '\x0d4d' (@).unicode-tricksThe combining character MALAYALAM AU LENGTH MARK' from the Unicode standard, defined by '\x0d57' (@).unicode-tricksThe combining character SINHALA SIGN AL-LAKUNA' from the Unicode standard, defined by '\x0dca' (@).unicode-tricksThe combining character SINHALA VOWEL SIGN AELA-PILLA' from the Unicode standard, defined by '\x0dcf' (@).unicode-tricksThe combining character SINHALA VOWEL SIGN GAYANUKITTA' from the Unicode standard, defined by '\x0ddf' (@).unicode-tricksThe combining character THAI CHARACTER SARA U' from the Unicode standard, defined by '\x0e38' (@).unicode-tricksThe combining character THAI CHARACTER SARA UU' from the Unicode standard, defined by '\x0e39' (@).unicode-tricksThe combining character THAI CHARACTER PHINTHU' from the Unicode standard, defined by '\x0e3a' (@).unicode-tricksThe combining character THAI CHARACTER MAI EK' from the Unicode standard, defined by '\x0e48' (@).unicode-tricksThe combining character THAI CHARACTER MAI THO' from the Unicode standard, defined by '\x0e49' (@).unicode-tricksThe combining character THAI CHARACTER MAI TRI' from the Unicode standard, defined by '\x0e4a' (@).unicode-tricksThe combining character THAI CHARACTER MAI CHATTAWA' from the Unicode standard, defined by '\x0e4b' (@).unicode-tricksThe combining character LAO VOWEL SIGN U' from the Unicode standard, defined by '\x0eb8' (@).unicode-tricksThe combining character LAO VOWEL SIGN UU' from the Unicode standard, defined by '\x0eb9' (@).unicode-tricksThe combining character LAO TONE MAI EK' from the Unicode standard, defined by '\x0ec8' (@).unicode-tricksThe combining character LAO TONE MAI THO' from the Unicode standard, defined by '\x0ec9' (@).unicode-tricksThe combining character LAO TONE MAI TI' from the Unicode standard, defined by '\x0eca' (@).unicode-tricksThe combining character LAO TONE MAI CATAWA' from the Unicode standard, defined by '\x0ecb' (@).unicode-tricksThe combining character #TIBETAN ASTROLOGICAL SIGN -KHYUD PA' from the Unicode standard, defined by '\x0f18' (@).unicode-tricksThe combining character &TIBETAN ASTROLOGICAL SIGN SDONG TSHUGS' from the Unicode standard, defined by '\x0f19' (@).unicode-tricksThe combining character TIBETAN MARK NGAS BZUNG NYI ZLA' from the Unicode standard, defined by '\x0f35' (@).unicode-tricksThe combining character "TIBETAN MARK NGAS BZUNG SGOR RTAGS' from the Unicode standard, defined by '\x0f37' (@).unicode-tricksThe combining character TIBETAN MARK TSA -PHRU' from the Unicode standard, defined by '\x0f39' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN AA' from the Unicode standard, defined by '\x0f71' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN I' from the Unicode standard, defined by '\x0f72' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN U' from the Unicode standard, defined by '\x0f74' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN E' from the Unicode standard, defined by '\x0f7a' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN EE' from the Unicode standard, defined by '\x0f7b' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN O' from the Unicode standard, defined by '\x0f7c' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN OO' from the Unicode standard, defined by '\x0f7d' (@).unicode-tricksThe combining character TIBETAN VOWEL SIGN REVERSED I' from the Unicode standard, defined by '\x0f80' (@).unicode-tricksThe combining character TIBETAN SIGN NYI ZLA NAA DA' from the Unicode standard, defined by '\x0f82' (@).unicode-tricksThe combining character TIBETAN SIGN SNA LDAN' from the Unicode standard, defined by '\x0f83' (@).unicode-tricksThe combining character TIBETAN MARK HALANTA' from the Unicode standard, defined by '\x0f84' (@).unicode-tricksThe combining character TIBETAN SIGN LCI RTAGS' from the Unicode standard, defined by '\x0f86' (@).unicode-tricksThe combining character TIBETAN SIGN YANG RTAGS' from the Unicode standard, defined by '\x0f87' (@).unicode-tricksThe combining character TIBETAN SUBJOINED LETTER SSA' from the Unicode standard, defined by '\x0fb5' (@).unicode-tricksThe combining character TIBETAN SUBJOINED LETTER HA' from the Unicode standard, defined by '\x0fb7' (@).unicode-tricksThe combining character TIBETAN SYMBOL PADMA GDAN' from the Unicode standard, defined by '\x0fc6' (@).unicode-tricksThe combining character MYANMAR VOWEL SIGN II' from the Unicode standard, defined by '\x102e' (@ ).unicode-tricksThe combining character MYANMAR SIGN DOT BELOW' from the Unicode standard, defined by '\x1037' (@ ).unicode-tricksThe combining character MYANMAR SIGN VIRAMA' from the Unicode standard, defined by '\x1039' (@ ).unicode-tricksThe combining character MYANMAR SIGN ASAT' from the Unicode standard, defined by '\x103a' (@ ).unicode-tricksThe combining character 'MYANMAR SIGN SHAN COUNCIL EMPHATIC TONE' from the Unicode standard, defined by '\x108d' (@!).unicode-tricksThe combining character 3ETHIOPIC COMBINING GEMINATION AND VOWEL LENGTH MARK' from the Unicode standard, defined by '\x135d' (@&).unicode-tricksThe combining character $ETHIOPIC COMBINING VOWEL LENGTH MARK' from the Unicode standard, defined by '\x135e' (@&).unicode-tricksThe combining character "ETHIOPIC COMBINING GEMINATION MARK' from the Unicode standard, defined by '\x135f' (@&).unicode-tricksThe combining character TAGALOG SIGN VIRAMA' from the Unicode standard, defined by '\x1714' (@.).unicode-tricksThe combining character HANUNOO SIGN PAMUDPOD' from the Unicode standard, defined by '\x1734' (@.).unicode-tricksThe combining character KHMER SIGN COENG' from the Unicode standard, defined by '\x17d2' (@/).unicode-tricksThe combining character KHMER SIGN ATTHACAN' from the Unicode standard, defined by '\x17dd' (@/).unicode-tricksThe combining character !MONGOLIAN LETTER ALI GALI DAGALGA' from the Unicode standard, defined by '\x18a9' (@1).unicode-tricksThe combining character LIMBU SIGN MUKPHRENG' from the Unicode standard, defined by '\x1939' (@2).unicode-tricksThe combining character LIMBU SIGN KEMPHRENG' from the Unicode standard, defined by '\x193a' (@2).unicode-tricksThe combining character LIMBU SIGN SA-I' from the Unicode standard, defined by '\x193b' (@2).unicode-tricksThe combining character BUGINESE VOWEL SIGN I' from the Unicode standard, defined by '\x1a17' (@4).unicode-tricksThe combining character BUGINESE VOWEL SIGN U' from the Unicode standard, defined by '\x1a18' (@4).unicode-tricksThe combining character TAI THAM SIGN SAKOT' from the Unicode standard, defined by '\x1a60' (@4).unicode-tricksThe combining character TAI THAM SIGN TONE-1' from the Unicode standard, defined by '\x1a75' (@4).unicode-tricksThe combining character TAI THAM SIGN TONE-2' from the Unicode standard, defined by '\x1a76' (@4).unicode-tricksThe combining character TAI THAM SIGN KHUEN TONE-3' from the Unicode standard, defined by '\x1a77' (@4).unicode-tricksThe combining character TAI THAM SIGN KHUEN TONE-4' from the Unicode standard, defined by '\x1a78' (@4).unicode-tricksThe combining character TAI THAM SIGN KHUEN TONE-5' from the Unicode standard, defined by '\x1a79' (@4).unicode-tricksThe combining character TAI THAM SIGN RA HAAM' from the Unicode standard, defined by '\x1a7a' (@4).unicode-tricksThe combining character TAI THAM SIGN MAI SAM' from the Unicode standard, defined by '\x1a7b' (@4).unicode-tricksThe combining character TAI THAM SIGN KHUEN-LUE KARAN' from the Unicode standard, defined by '\x1a7c' (@4).unicode-tricksThe combining character $TAI THAM COMBINING CRYPTOGRAMMIC DOT' from the Unicode standard, defined by '\x1a7f' (@4).unicode-tricksThe combining character #COMBINING DOUBLED CIRCUMFLEX ACCENT' from the Unicode standard, defined by '\x1ab0' (@5).unicode-tricksThe combining character COMBINING DIAERESIS-RING' from the Unicode standard, defined by '\x1ab1' (@5).unicode-tricksThe combining character COMBINING INFINITY' from the Unicode standard, defined by '\x1ab2' (@5).unicode-tricksThe combining character COMBINING DOWNWARDS ARROW' from the Unicode standard, defined by '\x1ab3' (@5).unicode-tricksThe combining character COMBINING TRIPLE DOT' from the Unicode standard, defined by '\x1ab4' (@5).unicode-tricksThe combining character COMBINING X-X BELOW' from the Unicode standard, defined by '\x1ab5' (@5).unicode-tricksThe combining character COMBINING WIGGLY LINE BELOW' from the Unicode standard, defined by '\x1ab6' (@5).unicode-tricksThe combining character COMBINING OPEN MARK BELOW' from the Unicode standard, defined by '\x1ab7' (@5).unicode-tricksThe combining character  COMBINING DOUBLE OPEN MARK BELOW' from the Unicode standard, defined by '\x1ab8' (@5).unicode-tricksThe combining character +COMBINING LIGHT CENTRALIZATION STROKE BELOW' from the Unicode standard, defined by '\x1ab9' (@5).unicode-tricksThe combining character ,COMBINING STRONG CENTRALIZATION STROKE BELOW' from the Unicode standard, defined by '\x1aba' (@5).unicode-tricksThe combining character COMBINING PARENTHESES ABOVE' from the Unicode standard, defined by '\x1abb' (@5).unicode-tricksThe combining character "COMBINING DOUBLE PARENTHESES ABOVE' from the Unicode standard, defined by '\x1abc' (@5).unicode-tricksThe combining character COMBINING PARENTHESES BELOW' from the Unicode standard, defined by '\x1abd' (@5).unicode-tricksThe combining character BALINESE SIGN REREKAN' from the Unicode standard, defined by '\x1b34' (@6).unicode-tricksThe combining character BALINESE VOWEL SIGN TEDUNG' from the Unicode standard, defined by '\x1b35' (@6).unicode-tricksThe combining character BALINESE ADEG ADEG' from the Unicode standard, defined by '\x1b44' (@6).unicode-tricksThe combining character 'BALINESE MUSICAL SYMBOL COMBINING TEGEH' from the Unicode standard, defined by '\x1b6b' (@6).unicode-tricksThe combining character 'BALINESE MUSICAL SYMBOL COMBINING ENDEP' from the Unicode standard, defined by '\x1b6c' (@6).unicode-tricksThe combining character (BALINESE MUSICAL SYMBOL COMBINING KEMPUL' from the Unicode standard, defined by '\x1b6d' (@6).unicode-tricksThe combining character (BALINESE MUSICAL SYMBOL COMBINING KEMPLI' from the Unicode standard, defined by '\x1b6e' (@6).unicode-tricksThe combining character )BALINESE MUSICAL SYMBOL COMBINING JEGOGAN' from the Unicode standard, defined by '\x1b6f' (@6).unicode-tricksThe combining character 5BALINESE MUSICAL SYMBOL COMBINING KEMPUL WITH JEGOGAN' from the Unicode standard, defined by '\x1b70' (@6).unicode-tricksThe combining character 5BALINESE MUSICAL SYMBOL COMBINING KEMPLI WITH JEGOGAN' from the Unicode standard, defined by '\x1b71' (@6).unicode-tricksThe combining character 'BALINESE MUSICAL SYMBOL COMBINING BENDE' from the Unicode standard, defined by '\x1b72' (@6).unicode-tricksThe combining character &BALINESE MUSICAL SYMBOL COMBINING GONG' from the Unicode standard, defined by '\x1b73' (@6).unicode-tricksThe combining character SUNDANESE SIGN PAMAAEH' from the Unicode standard, defined by '\x1baa' (@7).unicode-tricksThe combining character SUNDANESE SIGN VIRAMA' from the Unicode standard, defined by '\x1bab' (@7).unicode-tricksThe combining character BATAK SIGN TOMPI' from the Unicode standard, defined by '\x1be6' (@7).unicode-tricksThe combining character BATAK PANGOLAT' from the Unicode standard, defined by '\x1bf2' (@7).unicode-tricksThe combining character BATAK PANONGONAN' from the Unicode standard, defined by '\x1bf3' (@7).unicode-tricksThe combining character LEPCHA SIGN NUKTA' from the Unicode standard, defined by '\x1c37' (@8).unicode-tricksThe combining character VEDIC TONE KARSHANA' from the Unicode standard, defined by '\x1cd0' (@9).unicode-tricksThe combining character VEDIC TONE SHARA' from the Unicode standard, defined by '\x1cd1' (@9).unicode-tricksThe combining character VEDIC TONE PRENKHA' from the Unicode standard, defined by '\x1cd2' (@9).unicode-tricksThe combining character %VEDIC SIGN YAJURVEDIC MIDLINE SVARITA' from the Unicode standard, defined by '\x1cd4' (@9).unicode-tricksThe combining character 4VEDIC TONE YAJURVEDIC AGGRAVATED INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1cd5' (@9).unicode-tricksThe combining character )VEDIC TONE YAJURVEDIC INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1cd6' (@9).unicode-tricksThe combining character 1VEDIC TONE YAJURVEDIC KATHAKA INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1cd7' (@9).unicode-tricksThe combining character VEDIC TONE CANDRA BELOW' from the Unicode standard, defined by '\x1cd8' (@9).unicode-tricksThe combining character ;VEDIC TONE YAJURVEDIC KATHAKA INDEPENDENT SVARITA SCHROEDER' from the Unicode standard, defined by '\x1cd9' (@9).unicode-tricksThe combining character VEDIC TONE DOUBLE SVARITA' from the Unicode standard, defined by '\x1cda' (@9).unicode-tricksThe combining character VEDIC TONE TRIPLE SVARITA' from the Unicode standard, defined by '\x1cdb' (@9).unicode-tricksThe combining character VEDIC TONE KATHAKA ANUDATTA' from the Unicode standard, defined by '\x1cdc' (@9).unicode-tricksThe combining character VEDIC TONE DOT BELOW' from the Unicode standard, defined by '\x1cdd' (@9).unicode-tricksThe combining character VEDIC TONE TWO DOTS BELOW' from the Unicode standard, defined by '\x1cde' (@9).unicode-tricksThe combining character VEDIC TONE THREE DOTS BELOW' from the Unicode standard, defined by '\x1cdf' (@9).unicode-tricksThe combining character 0VEDIC TONE RIGVEDIC KASHMIRI INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1ce0' (@9).unicode-tricksThe combining character VEDIC SIGN VISARGA SVARITA' from the Unicode standard, defined by '\x1ce2' (@9).unicode-tricksThe combining character VEDIC SIGN VISARGA UDATTA' from the Unicode standard, defined by '\x1ce3' (@9).unicode-tricksThe combining character "VEDIC SIGN REVERSED VISARGA UDATTA' from the Unicode standard, defined by '\x1ce4' (@9).unicode-tricksThe combining character VEDIC SIGN VISARGA ANUDATTA' from the Unicode standard, defined by '\x1ce5' (@9).unicode-tricksThe combining character $VEDIC SIGN REVERSED VISARGA ANUDATTA' from the Unicode standard, defined by '\x1ce6' (@9).unicode-tricksThe combining character #VEDIC SIGN VISARGA UDATTA WITH TAIL' from the Unicode standard, defined by '\x1ce7' (@9).unicode-tricksThe combining character %VEDIC SIGN VISARGA ANUDATTA WITH TAIL' from the Unicode standard, defined by '\x1ce8' (@9).unicode-tricksThe combining character VEDIC SIGN TIRYAK' from the Unicode standard, defined by '\x1ced' (@9).unicode-tricksThe combining character VEDIC TONE CANDRA ABOVE' from the Unicode standard, defined by '\x1cf4' (@9).unicode-tricksThe combining character VEDIC TONE RING ABOVE' from the Unicode standard, defined by '\x1cf8' (@9).unicode-tricksThe combining character VEDIC TONE DOUBLE RING ABOVE' from the Unicode standard, defined by '\x1cf9' (@9).unicode-tricksThe combining character COMBINING DOTTED GRAVE ACCENT' from the Unicode standard, defined by '\x1dc0' (@;).unicode-tricksThe combining character COMBINING DOTTED ACUTE ACCENT' from the Unicode standard, defined by '\x1dc1' (@;).unicode-tricksThe combining character COMBINING SNAKE BELOW' from the Unicode standard, defined by '\x1dc2' (@;).unicode-tricksThe combining character COMBINING SUSPENSION MARK' from the Unicode standard, defined by '\x1dc3' (@;).unicode-tricksThe combining character COMBINING MACRON-ACUTE' from the Unicode standard, defined by '\x1dc4' (@;).unicode-tricksThe combining character COMBINING GRAVE-MACRON' from the Unicode standard, defined by '\x1dc5' (@;).unicode-tricksThe combining character COMBINING MACRON-GRAVE' from the Unicode standard, defined by '\x1dc6' (@;).unicode-tricksThe combining character COMBINING ACUTE-MACRON' from the Unicode standard, defined by '\x1dc7' (@;).unicode-tricksThe combining character COMBINING GRAVE-ACUTE-GRAVE' from the Unicode standard, defined by '\x1dc8' (@;).unicode-tricksThe combining character COMBINING ACUTE-GRAVE-ACUTE' from the Unicode standard, defined by '\x1dc9' (@;).unicode-tricksThe combining character $COMBINING LATIN SMALL LETTER R BELOW' from the Unicode standard, defined by '\x1dca' (@;).unicode-tricksThe combining character COMBINING BREVE-MACRON' from the Unicode standard, defined by '\x1dcb' (@;).unicode-tricksThe combining character COMBINING MACRON-BREVE' from the Unicode standard, defined by '\x1dcc' (@;).unicode-tricksThe combining character !COMBINING DOUBLE CIRCUMFLEX ABOVE' from the Unicode standard, defined by '\x1dcd' (@;).unicode-tricksThe combining character COMBINING OGONEK ABOVE' from the Unicode standard, defined by '\x1dce' (@;).unicode-tricksThe combining character COMBINING ZIGZAG BELOW' from the Unicode standard, defined by '\x1dcf' (@;).unicode-tricksThe combining character COMBINING IS BELOW' from the Unicode standard, defined by '\x1dd0' (@;).unicode-tricksThe combining character COMBINING UR ABOVE' from the Unicode standard, defined by '\x1dd1' (@;).unicode-tricksThe combining character COMBINING US ABOVE' from the Unicode standard, defined by '\x1dd2' (@;).unicode-tricksThe combining character 3COMBINING LATIN SMALL LETTER FLATTENED OPEN A ABOVE' from the Unicode standard, defined by '\x1dd3' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER AE' from the Unicode standard, defined by '\x1dd4' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER AO' from the Unicode standard, defined by '\x1dd5' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER AV' from the Unicode standard, defined by '\x1dd6' (@;).unicode-tricksThe combining character &COMBINING LATIN SMALL LETTER C CEDILLA' from the Unicode standard, defined by '\x1dd7' (@;).unicode-tricksThe combining character &COMBINING LATIN SMALL LETTER INSULAR D' from the Unicode standard, defined by '\x1dd8' (@;).unicode-tricksThe combining character  COMBINING LATIN SMALL LETTER ETH' from the Unicode standard, defined by '\x1dd9' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER G' from the Unicode standard, defined by '\x1dda' (@;).unicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL G' from the Unicode standard, defined by '\x1ddb' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER K' from the Unicode standard, defined by '\x1ddc' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER L' from the Unicode standard, defined by '\x1ddd' (@;).unicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL L' from the Unicode standard, defined by '\x1dde' (@;).unicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL M' from the Unicode standard, defined by '\x1ddf' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER N' from the Unicode standard, defined by '\x1de0' (@;).unicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL N' from the Unicode standard, defined by '\x1de1' (@;).unicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL R' from the Unicode standard, defined by '\x1de2' (@;).unicode-tricksThe combining character &COMBINING LATIN SMALL LETTER R ROTUNDA' from the Unicode standard, defined by '\x1de3' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER S' from the Unicode standard, defined by '\x1de4' (@;).unicode-tricksThe combining character #COMBINING LATIN SMALL LETTER LONG S' from the Unicode standard, defined by '\x1de5' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER Z' from the Unicode standard, defined by '\x1de6' (@;).unicode-tricksThe combining character "COMBINING LATIN SMALL LETTER ALPHA' from the Unicode standard, defined by '\x1de7' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER B' from the Unicode standard, defined by '\x1de8' (@;).unicode-tricksThe combining character !COMBINING LATIN SMALL LETTER BETA' from the Unicode standard, defined by '\x1de9' (@;).unicode-tricksThe combining character "COMBINING LATIN SMALL LETTER SCHWA' from the Unicode standard, defined by '\x1dea' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER F' from the Unicode standard, defined by '\x1deb' (@;).unicode-tricksThe combining character 7COMBINING LATIN SMALL LETTER L WITH DOUBLE MIDDLE TILDE' from the Unicode standard, defined by '\x1dec' (@;).unicode-tricksThe combining character ?COMBINING LATIN SMALL LETTER O WITH LIGHT CENTRALIZATION STROKE' from the Unicode standard, defined by '\x1ded' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER P' from the Unicode standard, defined by '\x1dee' (@;).unicode-tricksThe combining character  COMBINING LATIN SMALL LETTER ESH' from the Unicode standard, defined by '\x1def' (@;).unicode-tricksThe combining character ?COMBINING LATIN SMALL LETTER U WITH LIGHT CENTRALIZATION STROKE' from the Unicode standard, defined by '\x1df0' (@;).unicode-tricksThe combining character COMBINING LATIN SMALL LETTER W' from the Unicode standard, defined by '\x1df1' (@;).unicode-tricksThe combining character -COMBINING LATIN SMALL LETTER A WITH DIAERESIS' from the Unicode standard, defined by '\x1df2' (@;).unicode-tricksThe combining character -COMBINING LATIN SMALL LETTER O WITH DIAERESIS' from the Unicode standard, defined by '\x1df3' (@;).unicode-tricksThe combining character -COMBINING LATIN SMALL LETTER U WITH DIAERESIS' from the Unicode standard, defined by '\x1df4' (@;).unicode-tricksThe combining character COMBINING UP TACK ABOVE' from the Unicode standard, defined by '\x1df5' (@;).unicode-tricksThe combining character COMBINING DELETION MARK' from the Unicode standard, defined by '\x1dfb' (@;).unicode-tricksThe combining character %COMBINING DOUBLE INVERTED BREVE BELOW' from the Unicode standard, defined by '\x1dfc' (@;).unicode-tricksThe combining character COMBINING ALMOST EQUAL TO BELOW' from the Unicode standard, defined by '\x1dfd' (@;).unicode-tricksThe combining character COMBINING LEFT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x1dfe' (@;).unicode-tricksThe combining character 2COMBINING RIGHT ARROWHEAD AND DOWN ARROWHEAD BELOW' from the Unicode standard, defined by '\x1dff' (@;).unicode-tricksThe combining character COMBINING LEFT HARPOON ABOVE' from the Unicode standard, defined by '\x20d0' (@A).unicode-tricksThe combining character COMBINING RIGHT HARPOON ABOVE' from the Unicode standard, defined by '\x20d1' (@A).unicode-tricksThe combining character $COMBINING LONG VERTICAL LINE OVERLAY' from the Unicode standard, defined by '\x20d2' (@A).unicode-tricksThe combining character %COMBINING SHORT VERTICAL LINE OVERLAY' from the Unicode standard, defined by '\x20d3' (@A).unicode-tricksThe combining character #COMBINING ANTICLOCKWISE ARROW ABOVE' from the Unicode standard, defined by '\x20d4' (@A).unicode-tricksThe combining character COMBINING CLOCKWISE ARROW ABOVE' from the Unicode standard, defined by '\x20d5' (@A).unicode-tricksThe combining character COMBINING LEFT ARROW ABOVE' from the Unicode standard, defined by '\x20d6' (@A).unicode-tricksThe combining character COMBINING RIGHT ARROW ABOVE' from the Unicode standard, defined by '\x20d7' (@A).unicode-tricksThe combining character COMBINING RING OVERLAY' from the Unicode standard, defined by '\x20d8' (@A).unicode-tricksThe combining character  COMBINING CLOCKWISE RING OVERLAY' from the Unicode standard, defined by '\x20d9' (@A).unicode-tricksThe combining character $COMBINING ANTICLOCKWISE RING OVERLAY' from the Unicode standard, defined by '\x20da' (@A).unicode-tricksThe combining character COMBINING THREE DOTS ABOVE' from the Unicode standard, defined by '\x20db' (@A).unicode-tricksThe combining character COMBINING FOUR DOTS ABOVE' from the Unicode standard, defined by '\x20dc' (@A).unicode-tricksThe combining character  COMBINING LEFT RIGHT ARROW ABOVE' from the Unicode standard, defined by '\x20e1' (@A).unicode-tricksThe combining character !COMBINING REVERSE SOLIDUS OVERLAY' from the Unicode standard, defined by '\x20e5' (@A).unicode-tricksThe combining character (COMBINING DOUBLE VERTICAL STROKE OVERLAY' from the Unicode standard, defined by '\x20e6' (@A).unicode-tricksThe combining character COMBINING ANNUITY SYMBOL' from the Unicode standard, defined by '\x20e7' (@A).unicode-tricksThe combining character COMBINING TRIPLE UNDERDOT' from the Unicode standard, defined by '\x20e8' (@A).unicode-tricksThe combining character COMBINING WIDE BRIDGE ABOVE' from the Unicode standard, defined by '\x20e9' (@A).unicode-tricksThe combining character !COMBINING LEFTWARDS ARROW OVERLAY' from the Unicode standard, defined by '\x20ea' (@A).unicode-tricksThe combining character %COMBINING LONG DOUBLE SOLIDUS OVERLAY' from the Unicode standard, defined by '\x20eb' (@A).unicode-tricksThe combining character 0COMBINING RIGHTWARDS HARPOON WITH BARB DOWNWARDS' from the Unicode standard, defined by '\x20ec' (@A).unicode-tricksThe combining character /COMBINING LEFTWARDS HARPOON WITH BARB DOWNWARDS' from the Unicode standard, defined by '\x20ed' (@A).unicode-tricksThe combining character COMBINING LEFT ARROW BELOW' from the Unicode standard, defined by '\x20ee' (@A).unicode-tricksThe combining character COMBINING RIGHT ARROW BELOW' from the Unicode standard, defined by '\x20ef' (@A).unicode-tricksThe combining character COMBINING ASTERISK ABOVE' from the Unicode standard, defined by '\x20f0' (@A).unicode-tricksThe combining character COPTIC COMBINING NI ABOVE' from the Unicode standard, defined by '\x2cef' (@Y).unicode-tricksThe combining character COPTIC COMBINING SPIRITUS ASPER' from the Unicode standard, defined by '\x2cf0' (@Y).unicode-tricksThe combining character COPTIC COMBINING SPIRITUS LENIS' from the Unicode standard, defined by '\x2cf1' (@Y).unicode-tricksThe combining character TIFINAGH CONSONANT JOINER' from the Unicode standard, defined by '\x2d7f' (@Z).unicode-tricksThe combining character COMBINING CYRILLIC LETTER BE' from the Unicode standard, defined by '\x2de0' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER VE' from the Unicode standard, defined by '\x2de1' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER GHE' from the Unicode standard, defined by '\x2de2' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER DE' from the Unicode standard, defined by '\x2de3' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER ZHE' from the Unicode standard, defined by '\x2de4' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER ZE' from the Unicode standard, defined by '\x2de5' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER KA' from the Unicode standard, defined by '\x2de6' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER EL' from the Unicode standard, defined by '\x2de7' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER EM' from the Unicode standard, defined by '\x2de8' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER EN' from the Unicode standard, defined by '\x2de9' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER O' from the Unicode standard, defined by '\x2dea' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER PE' from the Unicode standard, defined by '\x2deb' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER ER' from the Unicode standard, defined by '\x2dec' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER ES' from the Unicode standard, defined by '\x2ded' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER TE' from the Unicode standard, defined by '\x2dee' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER HA' from the Unicode standard, defined by '\x2def' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER TSE' from the Unicode standard, defined by '\x2df0' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER CHE' from the Unicode standard, defined by '\x2df1' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER SHA' from the Unicode standard, defined by '\x2df2' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER SHCHA' from the Unicode standard, defined by '\x2df3' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER FITA' from the Unicode standard, defined by '\x2df4' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER ES-TE' from the Unicode standard, defined by '\x2df5' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER A' from the Unicode standard, defined by '\x2df6' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER IE' from the Unicode standard, defined by '\x2df7' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER DJERV' from the Unicode standard, defined by '\x2df8' (@[).unicode-tricksThe combining character &COMBINING CYRILLIC LETTER MONOGRAPH UK' from the Unicode standard, defined by '\x2df9' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER YAT' from the Unicode standard, defined by '\x2dfa' (@[).unicode-tricksThe combining character COMBINING CYRILLIC LETTER YU' from the Unicode standard, defined by '\x2dfb' (@[).unicode-tricksThe combining character $COMBINING CYRILLIC LETTER IOTIFIED A' from the Unicode standard, defined by '\x2dfc' (@[).unicode-tricksThe combining character $COMBINING CYRILLIC LETTER LITTLE YUS' from the Unicode standard, defined by '\x2dfd' (@[).unicode-tricksThe combining character !COMBINING CYRILLIC LETTER BIG YUS' from the Unicode standard, defined by '\x2dfe' (@[).unicode-tricksThe combining character *COMBINING CYRILLIC LETTER IOTIFIED BIG YUS' from the Unicode standard, defined by '\x2dff' (@[).unicode-tricksThe combining character IDEOGRAPHIC LEVEL TONE MARK' from the Unicode standard, defined by '\x302a' (@`).unicode-tricksThe combining character IDEOGRAPHIC RISING TONE MARK' from the Unicode standard, defined by '\x302b' (@`).unicode-tricksThe combining character IDEOGRAPHIC DEPARTING TONE MARK' from the Unicode standard, defined by '\x302c' (@`).unicode-tricksThe combining character IDEOGRAPHIC ENTERING TONE MARK' from the Unicode standard, defined by '\x302d' (@`).unicode-tricksThe combining character HANGUL SINGLE DOT TONE MARK' from the Unicode standard, defined by '\x302e' (@`).unicode-tricksThe combining character HANGUL DOUBLE DOT TONE MARK' from the Unicode standard, defined by '\x302f' (@`).unicode-tricksThe combining character -COMBINING KATAKANA-HIRAGANA VOICED SOUND MARK' from the Unicode standard, defined by '\x3099' (@a).unicode-tricksThe combining character 2COMBINING KATAKANA-HIRAGANA SEMI-VOICED SOUND MARK' from the Unicode standard, defined by '\x309a' (@a).unicode-tricksThe combining character COMBINING CYRILLIC VZMET' from the Unicode standard, defined by '\xa66f' (@).unicode-tricksThe combining character &COMBINING CYRILLIC LETTER UKRAINIAN IE' from the Unicode standard, defined by '\xa674' (@).unicode-tricksThe combining character COMBINING CYRILLIC LETTER I' from the Unicode standard, defined by '\xa675' (@).unicode-tricksThe combining character COMBINING CYRILLIC LETTER YI' from the Unicode standard, defined by '\xa676' (@).unicode-tricksThe combining character COMBINING CYRILLIC LETTER U' from the Unicode standard, defined by '\xa677' (@).unicode-tricksThe combining character #COMBINING CYRILLIC LETTER HARD SIGN' from the Unicode standard, defined by '\xa678' (@).unicode-tricksThe combining character COMBINING CYRILLIC LETTER YERU' from the Unicode standard, defined by '\xa679' (@).unicode-tricksThe combining character #COMBINING CYRILLIC LETTER SOFT SIGN' from the Unicode standard, defined by '\xa67a' (@).unicode-tricksThe combining character COMBINING CYRILLIC LETTER OMEGA' from the Unicode standard, defined by '\xa67b' (@).unicode-tricksThe combining character COMBINING CYRILLIC KAVYKA' from the Unicode standard, defined by '\xa67c' (@).unicode-tricksThe combining character COMBINING CYRILLIC PAYEROK' from the Unicode standard, defined by '\xa67d' (@).unicode-tricksThe combining character COMBINING CYRILLIC LETTER EF' from the Unicode standard, defined by '\xa69e' (@).unicode-tricksThe combining character $COMBINING CYRILLIC LETTER IOTIFIED E' from the Unicode standard, defined by '\xa69f' (@).unicode-tricksThe combining character BAMUM COMBINING MARK KOQNDON' from the Unicode standard, defined by '\xa6f0' (@).unicode-tricksThe combining character BAMUM COMBINING MARK TUKWENTIS' from the Unicode standard, defined by '\xa6f1' (@).unicode-tricksThe combining character SYLOTI NAGRI SIGN HASANTA' from the Unicode standard, defined by '\xa806' (@).unicode-tricksThe combining character SAURASHTRA SIGN VIRAMA' from the Unicode standard, defined by '\xa8c4' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT ZERO' from the Unicode standard, defined by '\xa8e0' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT ONE' from the Unicode standard, defined by '\xa8e1' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT TWO' from the Unicode standard, defined by '\xa8e2' (@).unicode-tricksThe combining character  COMBINING DEVANAGARI DIGIT THREE' from the Unicode standard, defined by '\xa8e3' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT FOUR' from the Unicode standard, defined by '\xa8e4' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT FIVE' from the Unicode standard, defined by '\xa8e5' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT SIX' from the Unicode standard, defined by '\xa8e6' (@).unicode-tricksThe combining character  COMBINING DEVANAGARI DIGIT SEVEN' from the Unicode standard, defined by '\xa8e7' (@).unicode-tricksThe combining character  COMBINING DEVANAGARI DIGIT EIGHT' from the Unicode standard, defined by '\xa8e8' (@).unicode-tricksThe combining character COMBINING DEVANAGARI DIGIT NINE' from the Unicode standard, defined by '\xa8e9' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER A' from the Unicode standard, defined by '\xa8ea' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER U' from the Unicode standard, defined by '\xa8eb' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER KA' from the Unicode standard, defined by '\xa8ec' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER NA' from the Unicode standard, defined by '\xa8ed' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER PA' from the Unicode standard, defined by '\xa8ee' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER RA' from the Unicode standard, defined by '\xa8ef' (@).unicode-tricksThe combining character COMBINING DEVANAGARI LETTER VI' from the Unicode standard, defined by '\xa8f0' (@).unicode-tricksThe combining character "COMBINING DEVANAGARI SIGN AVAGRAHA' from the Unicode standard, defined by '\xa8f1' (@).unicode-tricksThe combining character KAYAH LI TONE PLOPHU' from the Unicode standard, defined by '\xa92b' (@).unicode-tricksThe combining character KAYAH LI TONE CALYA' from the Unicode standard, defined by '\xa92c' (@).unicode-tricksThe combining character KAYAH LI TONE CALYA PLOPHU' from the Unicode standard, defined by '\xa92d' (@).unicode-tricksThe combining character  REJANG VIRAMA' from the Unicode standard, defined by '\xa953' (@).unicode-tricksThe combining character JAVANESE SIGN CECAK TELU' from the Unicode standard, defined by '\xa9b3' (@).unicode-tricksThe combining character JAVANESE PANGKON' from the Unicode standard, defined by '\xa9c0' (@).unicode-tricksThe combining character TAI VIET MAI KANG' from the Unicode standard, defined by '\xaab0' (@).unicode-tricksThe combining character TAI VIET VOWEL I' from the Unicode standard, defined by '\xaab2' (@).unicode-tricksThe combining character TAI VIET VOWEL UE' from the Unicode standard, defined by '\xaab3' (@).unicode-tricksThe combining character TAI VIET VOWEL U' from the Unicode standard, defined by '\xaab4' (@).unicode-tricksThe combining character TAI VIET MAI KHIT' from the Unicode standard, defined by '\xaab7' (@).unicode-tricksThe combining character TAI VIET VOWEL IA' from the Unicode standard, defined by '\xaab8' (@).unicode-tricksThe combining character TAI VIET VOWEL AM' from the Unicode standard, defined by '\xaabe' (@).unicode-tricksThe combining character TAI VIET TONE MAI EK' from the Unicode standard, defined by '\xaabf' (@).unicode-tricksThe combining character TAI VIET TONE MAI THO' from the Unicode standard, defined by '\xaac1' (@).unicode-tricksThe combining character MEETEI MAYEK VIRAMA' from the Unicode standard, defined by '\xaaf6' (@).unicode-tricksThe combining character MEETEI MAYEK APUN IYEK' from the Unicode standard, defined by '\xabed' (@).unicode-tricksThe combining character !HEBREW POINT JUDEO-SPANISH VARIKA' from the Unicode standard, defined by '\xfb1e' (@).unicode-tricksThe combining character COMBINING LIGATURE LEFT HALF' from the Unicode standard, defined by '\xfe20' (@).unicode-tricksThe combining character COMBINING LIGATURE RIGHT HALF' from the Unicode standard, defined by '\xfe21' (@).unicode-tricksThe combining character  COMBINING DOUBLE TILDE LEFT HALF' from the Unicode standard, defined by '\xfe22' (@).unicode-tricksThe combining character !COMBINING DOUBLE TILDE RIGHT HALF' from the Unicode standard, defined by '\xfe23' (@).unicode-tricksThe combining character COMBINING MACRON LEFT HALF' from the Unicode standard, defined by '\xfe24' (@).unicode-tricksThe combining character COMBINING MACRON RIGHT HALF' from the Unicode standard, defined by '\xfe25' (@).unicode-tricksThe combining character COMBINING CONJOINING MACRON' from the Unicode standard, defined by '\xfe26' (@).unicode-tricksThe combining character "COMBINING LIGATURE LEFT HALF BELOW' from the Unicode standard, defined by '\xfe27' (@).unicode-tricksThe combining character #COMBINING LIGATURE RIGHT HALF BELOW' from the Unicode standard, defined by '\xfe28' (@).unicode-tricksThe combining character COMBINING TILDE LEFT HALF BELOW' from the Unicode standard, defined by '\xfe29' (@).unicode-tricksThe combining character  COMBINING TILDE RIGHT HALF BELOW' from the Unicode standard, defined by '\xfe2a' (@).unicode-tricksThe combining character  COMBINING MACRON LEFT HALF BELOW' from the Unicode standard, defined by '\xfe2b' (@).unicode-tricksThe combining character !COMBINING MACRON RIGHT HALF BELOW' from the Unicode standard, defined by '\xfe2c' (@).unicode-tricksThe combining character !COMBINING CONJOINING MACRON BELOW' from the Unicode standard, defined by '\xfe2d' (@).unicode-tricksThe combining character "COMBINING CYRILLIC TITLO LEFT HALF' from the Unicode standard, defined by '\xfe2e' (@).unicode-tricksThe combining character #COMBINING CYRILLIC TITLO RIGHT HALF' from the Unicode standard, defined by '\xfe2f' (@).unicode-tricksThe combining character +PHAISTOS DISC SIGN COMBINING OBLIQUE STROKE' from the Unicode standard, defined by  '\x101fd' (@).unicode-tricksThe combining character COPTIC EPACT THOUSANDS MARK' from the Unicode standard, defined by  '\x102e0' (@).unicode-tricksThe combining character COMBINING OLD PERMIC LETTER AN' from the Unicode standard, defined by  '\x10376' (@).unicode-tricksThe combining character COMBINING OLD PERMIC LETTER DOI' from the Unicode standard, defined by  '\x10377' (@).unicode-tricksThe combining character  COMBINING OLD PERMIC LETTER ZATA' from the Unicode standard, defined by  '\x10378' (@).unicode-tricksThe combining character !COMBINING OLD PERMIC LETTER NENOE' from the Unicode standard, defined by  '\x10379' (@).unicode-tricksThe combining character COMBINING OLD PERMIC LETTER SII' from the Unicode standard, defined by  '\x1037a' (@).unicode-tricksThe combining character !KHAROSHTHI SIGN DOUBLE RING BELOW' from the Unicode standard, defined by  '\x10a0d' (@).unicode-tricksThe combining character KHAROSHTHI SIGN VISARGA' from the Unicode standard, defined by  '\x10a0f' (@).unicode-tricksThe combining character KHAROSHTHI SIGN BAR ABOVE' from the Unicode standard, defined by  '\x10a38' (@).unicode-tricksThe combining character KHAROSHTHI SIGN CAUDA' from the Unicode standard, defined by  '\x10a39' (@).unicode-tricksThe combining character KHAROSHTHI SIGN DOT BELOW' from the Unicode standard, defined by  '\x10a3a' (@).unicode-tricksThe combining character KHAROSHTHI VIRAMA' from the Unicode standard, defined by  '\x10a3f' (@).unicode-tricksThe combining character "MANICHAEAN ABBREVIATION MARK ABOVE' from the Unicode standard, defined by  '\x10ae5' (@).unicode-tricksThe combining character "MANICHAEAN ABBREVIATION MARK BELOW' from the Unicode standard, defined by  '\x10ae6' (@).unicode-tricksThe combining character  BRAHMI VIRAMA' from the Unicode standard, defined by  '\x11046' (@Ơ).unicode-tricksThe combining character BRAHMI NUMBER JOINER' from the Unicode standard, defined by  '\x1107f' (@).unicode-tricksThe combining character KAITHI SIGN VIRAMA' from the Unicode standard, defined by  '\x110b9' (@).unicode-tricksThe combining character KAITHI SIGN NUKTA' from the Unicode standard, defined by  '\x110ba' (@).unicode-tricksThe combining character CHAKMA SIGN CANDRABINDU' from the Unicode standard, defined by  '\x11100' (@).unicode-tricksThe combining character CHAKMA SIGN ANUSVARA' from the Unicode standard, defined by  '\x11101' (@).unicode-tricksThe combining character CHAKMA SIGN VISARGA' from the Unicode standard, defined by  '\x11102' (@).unicode-tricksThe combining character CHAKMA VOWEL SIGN A' from the Unicode standard, defined by  '\x11127' (@).unicode-tricksThe combining character  CHAKMA VIRAMA' from the Unicode standard, defined by  '\x11133' (@).unicode-tricksThe combining character CHAKMA MAAYYAA' from the Unicode standard, defined by  '\x11134' (@).unicode-tricksThe combining character MAHAJANI SIGN NUKTA' from the Unicode standard, defined by  '\x11173' (@).unicode-tricksThe combining character SHARADA SIGN VIRAMA' from the Unicode standard, defined by  '\x111c0' (@).unicode-tricksThe combining character SHARADA SIGN NUKTA' from the Unicode standard, defined by  '\x111ca' (@ʣ).unicode-tricksThe combining character KHOJKI SIGN VIRAMA' from the Unicode standard, defined by  '\x11235' (@).unicode-tricksThe combining character KHOJKI SIGN NUKTA' from the Unicode standard, defined by  '\x11236' (@).unicode-tricksThe combining character KHUDAWADI SIGN NUKTA' from the Unicode standard, defined by  '\x112e9' (@).unicode-tricksThe combining character KHUDAWADI SIGN VIRAMA' from the Unicode standard, defined by  '\x112ea' (@).unicode-tricksThe combining character GRANTHA SIGN NUKTA' from the Unicode standard, defined by  '\x1133c' (@).unicode-tricksThe combining character GRANTHA VOWEL SIGN AA' from the Unicode standard, defined by  '\x1133e' (@).unicode-tricksThe combining character GRANTHA SIGN VIRAMA' from the Unicode standard, defined by  '\x1134d' (@ͦ).unicode-tricksThe combining character GRANTHA AU LENGTH MARK' from the Unicode standard, defined by  '\x11357' (@צ).unicode-tricksThe combining character COMBINING GRANTHA DIGIT ZERO' from the Unicode standard, defined by  '\x11366' (@).unicode-tricksThe combining character COMBINING GRANTHA DIGIT ONE' from the Unicode standard, defined by  '\x11367' (@).unicode-tricksThe combining character COMBINING GRANTHA DIGIT TWO' from the Unicode standard, defined by  '\x11368' (@).unicode-tricksThe combining character COMBINING GRANTHA DIGIT THREE' from the Unicode standard, defined by  '\x11369' (@).unicode-tricksThe combining character COMBINING GRANTHA DIGIT FOUR' from the Unicode standard, defined by  '\x1136a' (@).unicode-tricksThe combining character COMBINING GRANTHA DIGIT FIVE' from the Unicode standard, defined by  '\x1136b' (@).unicode-tricksThe combining character COMBINING GRANTHA DIGIT SIX' from the Unicode standard, defined by  '\x1136c' (@).unicode-tricksThe combining character COMBINING GRANTHA LETTER A' from the Unicode standard, defined by  '\x11370' (@).unicode-tricksThe combining character COMBINING GRANTHA LETTER KA' from the Unicode standard, defined by  '\x11371' (@).unicode-tricksThe combining character COMBINING GRANTHA LETTER NA' from the Unicode standard, defined by  '\x11372' (@).unicode-tricksThe combining character COMBINING GRANTHA LETTER VI' from the Unicode standard, defined by  '\x11373' (@).unicode-tricksThe combining character COMBINING GRANTHA LETTER PA' from the Unicode standard, defined by  '\x11374' (@).unicode-tricksThe combining character NEWA SIGN VIRAMA' from the Unicode standard, defined by  '\x11442' (@¨).unicode-tricksThe combining character NEWA SIGN NUKTA' from the Unicode standard, defined by  '\x11446' (@ƨ).unicode-tricksThe combining character TIRHUTA VOWEL SIGN AA' from the Unicode standard, defined by  '\x114b0' (@).unicode-tricksThe combining character TIRHUTA VOWEL SIGN SHORT E' from the Unicode standard, defined by  '\x114ba' (@).unicode-tricksThe combining character TIRHUTA VOWEL SIGN SHORT O' from the Unicode standard, defined by  '\x114bd' (@).unicode-tricksThe combining character TIRHUTA SIGN VIRAMA' from the Unicode standard, defined by  '\x114c2' (@©).unicode-tricksThe combining character TIRHUTA SIGN NUKTA' from the Unicode standard, defined by  '\x114c3' (@é).unicode-tricksThe combining character SIDDHAM VOWEL SIGN AA' from the Unicode standard, defined by  '\x115af' (@).unicode-tricksThe combining character SIDDHAM SIGN VIRAMA' from the Unicode standard, defined by  '\x115bf' (@).unicode-tricksThe combining character SIDDHAM SIGN NUKTA' from the Unicode standard, defined by  '\x115c0' (@).unicode-tricksThe combining character MODI SIGN VIRAMA' from the Unicode standard, defined by  '\x1163f' (@).unicode-tricksThe combining character TAKRI SIGN VIRAMA' from the Unicode standard, defined by  '\x116b6' (@).unicode-tricksThe combining character TAKRI SIGN NUKTA' from the Unicode standard, defined by  '\x116b7' (@).unicode-tricksThe combining character AHOM SIGN KILLER' from the Unicode standard, defined by  '\x1172b' (@).unicode-tricksThe combining character BHAIKSUKI SIGN VIRAMA' from the Unicode standard, defined by  '\x11c3f' (@).unicode-tricksThe combining character BASSA VAH COMBINING HIGH TONE' from the Unicode standard, defined by  '\x16af0' (@).unicode-tricksThe combining character BASSA VAH COMBINING LOW TONE' from the Unicode standard, defined by  '\x16af1' (@).unicode-tricksThe combining character BASSA VAH COMBINING MID TONE' from the Unicode standard, defined by  '\x16af2' (@).unicode-tricksThe combining character  BASSA VAH COMBINING LOW-MID TONE' from the Unicode standard, defined by  '\x16af3' (@).unicode-tricksThe combining character !BASSA VAH COMBINING HIGH-LOW TONE' from the Unicode standard, defined by  '\x16af4' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM TUB' from the Unicode standard, defined by  '\x16b30' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM SO' from the Unicode standard, defined by  '\x16b31' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM KES' from the Unicode standard, defined by  '\x16b32' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM KHAV' from the Unicode standard, defined by  '\x16b33' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM SUAM' from the Unicode standard, defined by  '\x16b34' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM HOM' from the Unicode standard, defined by  '\x16b35' (@).unicode-tricksThe combining character PAHAWH HMONG MARK CIM TAUM' from the Unicode standard, defined by  '\x16b36' (@).unicode-tricksThe combining character DUPLOYAN DOUBLE MARK' from the Unicode standard, defined by  '\x1bc9e' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING STEM' from the Unicode standard, defined by  '\x1d165' (@).unicode-tricksThe combining character *MUSICAL SYMBOL COMBINING SPRECHGESANG STEM' from the Unicode standard, defined by  '\x1d166' (@).unicode-tricksThe combining character "MUSICAL SYMBOL COMBINING TREMOLO-1' from the Unicode standard, defined by  '\x1d167' (@).unicode-tricksThe combining character "MUSICAL SYMBOL COMBINING TREMOLO-2' from the Unicode standard, defined by  '\x1d168' (@).unicode-tricksThe combining character "MUSICAL SYMBOL COMBINING TREMOLO-3' from the Unicode standard, defined by  '\x1d169' (@).unicode-tricksThe combining character )MUSICAL SYMBOL COMBINING AUGMENTATION DOT' from the Unicode standard, defined by  '\x1d16d' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-1' from the Unicode standard, defined by  '\x1d16e' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-2' from the Unicode standard, defined by  '\x1d16f' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-3' from the Unicode standard, defined by  '\x1d170' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-4' from the Unicode standard, defined by  '\x1d171' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-5' from the Unicode standard, defined by  '\x1d172' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING ACCENT' from the Unicode standard, defined by  '\x1d17b' (@).unicode-tricksThe combining character !MUSICAL SYMBOL COMBINING STACCATO' from the Unicode standard, defined by  '\x1d17c' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING TENUTO' from the Unicode standard, defined by  '\x1d17d' (@).unicode-tricksThe combining character &MUSICAL SYMBOL COMBINING STACCATISSIMO' from the Unicode standard, defined by  '\x1d17e' (@).unicode-tricksThe combining character  MUSICAL SYMBOL COMBINING MARCATO' from the Unicode standard, defined by  '\x1d17f' (@).unicode-tricksThe combining character )MUSICAL SYMBOL COMBINING MARCATO-STACCATO' from the Unicode standard, defined by  '\x1d180' (@).unicode-tricksThe combining character (MUSICAL SYMBOL COMBINING ACCENT-STACCATO' from the Unicode standard, defined by  '\x1d181' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING LOURE' from the Unicode standard, defined by  '\x1d182' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING DOIT' from the Unicode standard, defined by  '\x1d185' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING RIP' from the Unicode standard, defined by  '\x1d186' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLIP' from the Unicode standard, defined by  '\x1d187' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING SMEAR' from the Unicode standard, defined by  '\x1d188' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING BEND' from the Unicode standard, defined by  '\x1d189' (@).unicode-tricksThe combining character &MUSICAL SYMBOL COMBINING DOUBLE TONGUE' from the Unicode standard, defined by  '\x1d18a' (@).unicode-tricksThe combining character &MUSICAL SYMBOL COMBINING TRIPLE TONGUE' from the Unicode standard, defined by  '\x1d18b' (@).unicode-tricksThe combining character !MUSICAL SYMBOL COMBINING DOWN BOW' from the Unicode standard, defined by  '\x1d1aa' (@).unicode-tricksThe combining character MUSICAL SYMBOL COMBINING UP BOW' from the Unicode standard, defined by  '\x1d1ab' (@).unicode-tricksThe combining character !MUSICAL SYMBOL COMBINING HARMONIC' from the Unicode standard, defined by  '\x1d1ac' (@).unicode-tricksThe combining character 'MUSICAL SYMBOL COMBINING SNAP PIZZICATO' from the Unicode standard, defined by  '\x1d1ad' (@).unicode-tricksThe combining character COMBINING GREEK MUSICAL TRISEME' from the Unicode standard, defined by  '\x1d242' (@¤).unicode-tricksThe combining character !COMBINING GREEK MUSICAL TETRASEME' from the Unicode standard, defined by  '\x1d243' (@ä).unicode-tricksThe combining character !COMBINING GREEK MUSICAL PENTASEME' from the Unicode standard, defined by  '\x1d244' (@Ĥ).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER AZU' from the Unicode standard, defined by  '\x1e000' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER BUKY' from the Unicode standard, defined by  '\x1e001' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER VEDE' from the Unicode standard, defined by  '\x1e002' (@).unicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER GLAGOLI' from the Unicode standard, defined by  '\x1e003' (@).unicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER DOBRO' from the Unicode standard, defined by  '\x1e004' (@).unicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER YESTU' from the Unicode standard, defined by  '\x1e005' (@).unicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER ZHIVETE' from the Unicode standard, defined by  '\x1e006' (@).unicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER ZEMLJA' from the Unicode standard, defined by  '\x1e008' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER IZHE' from the Unicode standard, defined by  '\x1e009' (@).unicode-tricksThe combining character (COMBINING GLAGOLITIC LETTER INITIAL IZHE' from the Unicode standard, defined by  '\x1e00a' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER I' from the Unicode standard, defined by  '\x1e00b' (@).unicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER DJERVI' from the Unicode standard, defined by  '\x1e00c' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER KAKO' from the Unicode standard, defined by  '\x1e00d' (@).unicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER LJUDIJE' from the Unicode standard, defined by  '\x1e00e' (@).unicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER MYSLITE' from the Unicode standard, defined by  '\x1e00f' (@).unicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER NASHI' from the Unicode standard, defined by  '\x1e010' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER ONU' from the Unicode standard, defined by  '\x1e011' (@).unicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER POKOJI' from the Unicode standard, defined by  '\x1e012' (@).unicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER RITSI' from the Unicode standard, defined by  '\x1e013' (@).unicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER SLOVO' from the Unicode standard, defined by  '\x1e014' (@).unicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER TVRIDO' from the Unicode standard, defined by  '\x1e015' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER UKU' from the Unicode standard, defined by  '\x1e016' (@).unicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER FRITU' from the Unicode standard, defined by  '\x1e017' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER HERU' from the Unicode standard, defined by  '\x1e018' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER SHTA' from the Unicode standard, defined by  '\x1e01b' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER TSI' from the Unicode standard, defined by  '\x1e01c' (@).unicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER CHRIVI' from the Unicode standard, defined by  '\x1e01d' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER SHA' from the Unicode standard, defined by  '\x1e01e' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER YERU' from the Unicode standard, defined by  '\x1e01f' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER YERI' from the Unicode standard, defined by  '\x1e020' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER YATI' from the Unicode standard, defined by  '\x1e021' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YU' from the Unicode standard, defined by  '\x1e023' (@).unicode-tricksThe combining character %COMBINING GLAGOLITIC LETTER SMALL YUS' from the Unicode standard, defined by  '\x1e024' (@).unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YO' from the Unicode standard, defined by  '\x1e026' (@).unicode-tricksThe combining character -COMBINING GLAGOLITIC LETTER IOTATED SMALL YUS' from the Unicode standard, defined by  '\x1e027' (@).unicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER BIG YUS' from the Unicode standard, defined by  '\x1e028' (@).unicode-tricksThe combining character +COMBINING GLAGOLITIC LETTER IOTATED BIG YUS' from the Unicode standard, defined by  '\x1e029' (@).unicode-tricksThe combining character  COMBINING GLAGOLITIC LETTER FITA' from the Unicode standard, defined by  '\x1e02a' (@).unicode-tricksThe combining character $MENDE KIKAKUI COMBINING NUMBER TEENS' from the Unicode standard, defined by  '\x1e8d0' (@).unicode-tricksThe combining character #MENDE KIKAKUI COMBINING NUMBER TENS' from the Unicode standard, defined by  '\x1e8d1' (@).unicode-tricksThe combining character 'MENDE KIKAKUI COMBINING NUMBER HUNDREDS' from the Unicode standard, defined by  '\x1e8d2' (@).unicode-tricksThe combining character (MENDE KIKAKUI COMBINING NUMBER THOUSANDS' from the Unicode standard, defined by  '\x1e8d3' (@).unicode-tricksThe combining character ,MENDE KIKAKUI COMBINING NUMBER TEN THOUSANDS' from the Unicode standard, defined by  '\x1e8d4' (@).unicode-tricksThe combining character 0MENDE KIKAKUI COMBINING NUMBER HUNDRED THOUSANDS' from the Unicode standard, defined by  '\x1e8d5' (@).unicode-tricksThe combining character 'MENDE KIKAKUI COMBINING NUMBER MILLIONS' from the Unicode standard, defined by  '\x1e8d6' (@).unicode-tricksThe combining character ADLAM ALIF LENGTHENER' from the Unicode standard, defined by  '\x1e944' (@).unicode-tricksThe combining character ADLAM VOWEL LENGTHENER' from the Unicode standard, defined by  '\x1e945' (@).unicode-tricksThe combining character ADLAM GEMINATION MARK' from the Unicode standard, defined by  '\x1e946' (@).unicode-tricksThe combining character  ADLAM HAMZA' from the Unicode standard, defined by  '\x1e947' (@).unicode-tricksThe combining character ADLAM CONSONANT MODIFIER' from the Unicode standard, defined by  '\x1e948' (@).unicode-tricksThe combining character !ADLAM GEMINATE CONSONANT MODIFIER' from the Unicode standard, defined by  '\x1e949' (@).unicode-tricksThe combining character  ADLAM NUKTA' from the Unicode standard, defined by  '\x1e94a' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d6' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d5' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d4' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d3' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d2' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d1' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e8d0' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e02a' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e029' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e028' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e027' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e026' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e024' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e023' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e021' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e020' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e01f' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e01e' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e01d' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e01c' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e01b' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e018' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e017' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e016' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e015' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e014' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e013' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e012' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e011' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e010' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e00f' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e00e' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e00d' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e00c' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e00b' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e00a' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e009' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e008' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e006' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e005' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e004' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e003' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e002' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e001' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1e000' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d244' (@Ĥ).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d243' (@ä).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d242' (@¤).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d1ad' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d1ac' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d1ab' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d1aa' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d18b' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d18a' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d189' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d188' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d187' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d186' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d185' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d182' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d181' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d180' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d17f' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d17e' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d17d' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d17c' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d17b' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d172' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d171' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d170' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d16f' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d16e' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d16d' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d169' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d168' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d167' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d166' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1d165' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x16af4' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x16af3' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x16af2' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x16af1' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x16af0' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11374' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11373' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11372' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11371' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11370' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1136c' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1136b' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1136a' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11369' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11368' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11367' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x11366' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x1037a' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x10379' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x10378' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x10377' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x10376' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by  '\x101fd' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe2f' (@).unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe2e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe2d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe2c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe2b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe2a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe29' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe28' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe27' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe26' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe25' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe24' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe23' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe22' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe21' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xfe20' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8f1' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8f0' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8ef' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8ee' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8ed' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8ec' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8eb' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8ea' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e9' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e8' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e7' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e6' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e5' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e4' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e3' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e2' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e1' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa8e0' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa6f1' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa6f0' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa69f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa69e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa67d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa67c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa67b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa67a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa679' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa678' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa677' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa676' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa675' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa674' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\xa66f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x309a' (@a). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x3099' (@a). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dff' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dfe' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dfd' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dfc' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dfb' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dfa' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df9' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df8' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df7' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df6' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df5' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df4' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df3' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df2' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df1' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2df0' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2def' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dee' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2ded' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dec' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2deb' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2dea' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de9' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de8' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de7' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de6' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de5' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de4' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de3' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de2' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de1' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2de0' (@[). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2cf1' (@Y). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2cf0' (@Y). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x2cef' (@Y). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20f0' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20ef' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20ee' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20ed' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20ec' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20eb' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20ea' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20e9' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20e8' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20e7' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20e6' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20e5' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20e1' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20dc' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20db' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20da' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d9' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d8' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d7' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d6' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d5' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d4' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d3' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d2' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d1' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x20d0' (@A). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dff' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dfe' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dfd' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dfc' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dfb' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1df5' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1df4' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1df3' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1df2' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1df1' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1df0' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1def' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dee' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ded' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dec' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1deb' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dea' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de9' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de8' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de7' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de6' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de5' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de4' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de3' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de2' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de1' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1de0' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ddf' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dde' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ddd' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ddc' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ddb' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dda' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd9' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd8' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd7' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd6' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd5' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd4' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd3' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd2' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd1' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dd0' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dcf' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dce' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dcd' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dcc' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dcb' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dca' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc9' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc8' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc7' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc6' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc5' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc4' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc3' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc2' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc1' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1dc0' (@;). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b73' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b72' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b71' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b70' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b6f' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b6e' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b6d' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b6c' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1b6b' (@6). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1abd' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1abc' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1abb' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1aba' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab9' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab8' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab7' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab6' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab5' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab4' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab3' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab2' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab1' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1ab0' (@5). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x1a7f' (@4). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x135f' (@&). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x135e' (@&). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x135d' (@&). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07f3' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07f2' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07f1' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07f0' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07ef' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07ee' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07ed' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07ec' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x07eb' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0487' (@ ). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0486' (@ ). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0485' (@ ). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0484' (@ ). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0483' (@ ). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x036f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x036e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x036d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x036c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x036b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x036a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0369' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0368' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0367' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0366' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0365' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0364' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0363' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0362' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0361' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0360' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x035f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x035e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x035d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x035c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x035b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x035a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0359' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0358' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0357' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0356' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0355' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0354' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0353' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0352' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0351' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0350' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x034e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x034d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x034c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x034b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x034a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0349' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0348' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0347' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0346' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0345' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0344' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0343' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0342' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0341' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0340' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x033f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x033e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x033d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x033c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x033b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x033a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0339' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0338' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0337' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0336' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0335' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0334' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0333' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0332' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0331' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0330' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x032f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x032e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x032d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x032c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x032b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x032a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0329' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0328' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0327' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0326' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0325' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0324' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0323' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0322' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0321' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0320' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x031f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x031e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x031d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x031c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x031b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x031a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0319' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0318' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0317' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0316' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0315' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0314' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0313' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0312' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0311' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0310' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x030f' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x030e' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x030d' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x030c' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x030b' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x030a' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0309' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0308' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0307' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0306' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0305' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0304' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0303' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0302' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0301' (@). unicode-tricksA pattern synonym for , the name without the  Combining part, defined by '\x0300' (@). unicode-tricksConvert the given  to a  in Unicode, this codepoints need a preceding codepoint to be applied to. unicode-tricksChecks if the given  is a combining character. unicode-tricksConvert the given  to its corresponding . If the given  is not a  combining! character, an error is produced. unicode-tricksConvert the given  to its corresponding  wrapped in a  data constructor. If the given  is not a  combining character,  is returned. unicode-tricksConvert the given acter to a 2-tuple that contains the "root" character, and a set of s that can be applied to construct that character. Characters that do not contain a combining character return an empty list for the list of s.For a  that is a  itself, it will return a 2-tuple with that character as first item, and an empty list of s. unicode-tricksConvert the given :acter to its "root" character that omits all the applied s. If the given  acter is a  itself, then this is returned. unicode-tricks Remove the  s in the  and the ones that are applied to a character through "composition". This function is useful for example to remove diacritics from a  object. unicode-tricks4Convert a given character that can be represented a  and a = to a 2-tuple that contains this combination. The returning  (the first item in the 2-tuple) can still be a composed form, and thus can sometimes be passed again through this function. unicode-tricks,Try to combine the given character with the s in the list, by applying   on the items left-to-right. The result is a 2-tuple with a more dedicated $acter (if possible), and a list of ;s that could not be applied. This is a flipped version of  . unicode-tricks,Try to combine the given character with the s in the list, by applying   on the items left-to-right. The result is a 2-tuple with a more dedicated $acter (if possible), and a list of ;s that could not be applied. This is a flipped version of  . unicode-tricksCheck if for the given  and the given  a dedicated  exists that is the equivalent. If so, that dedicated character is wrapped in a ; * otherwise. This is a flipped version of  . unicode-tricksCheck if for the given  and the given  a dedicated  exists that is the equivalent. If so, that dedicated character is wrapped in a ; * otherwise. This is a flipped version of  . unicode-tricks The given # to convert to a Unicode codepoint.unicode-tricks A Unicode )acter that is the codepoint of the given . The unicode-tricks The given acter to check.unicode-tricks if the given  acter is a combining character;  otherwise. unicode-tricks The given  to convert.unicode-tricksThe corresponding  if such character exists. unicode-tricks The given  to convert to a .unicode-tricksThe equivalent  for the given  wrapped in a  ; if the  is not a combining character, . unicode-tricksThe acter to decompose.unicode-tricksA 2-tuple with the "root" acter and the list of s that are applied to it. unicode-tricksThe /acter that should be stripped from its applied s.unicode-tricks The "root" acter that is the given  acter stripped from the applied s. unicode-tricks The given  object to strip /s from, both through filtering and decomposing.unicode-tricksA  object where the s are filtered out. unicode-tricks The given acter to decompose.unicode-tricksA 2-tuple of a  acter and a  wrapped in a  if the  can be decomposed;  otherwise. unicode-tricks The given acter to start with.unicode-tricks The list of  s to apply. unicode-tricks The list of  s to apply.unicode-tricks The given acter to start with. unicode-tricks The given acter that is combined with a .unicode-tricks The given  that is applied to the given acter.unicode-tricks A dedicated acter wrapped in a  if such character exists,  otherwise. unicode-tricks The given  that is applied to the given acter.unicode-tricks The given acter that is combined with a .unicode-tricks A dedicated acter wrapped in a  if such character exists,  otherwise.    88(Support for chess characters in unicode.hapytexeu+gh@gmail.com experimentalPOSIXSafe( unicode-tricks?Chess pieces that can be represented in Unicode. These are the king, queen, rook, bishop, knight, pawn, and  equihopper, over 0, 90, 180, and 270 degrees; and the knight over 45, 135, 225, and 315 degrees in  ,   and  . Furthermore one can draw a  knight-queen,  knight-rook, and  knight-bishop3 pieces can be drawn without rotation and only in   or  . unicode-tricksStandard pieces drawn in black, white, or neutral and with rotation. unicode-tricksKnights6 have unicode characters to render these rotated over 45, 135, 225 and 315 degrees. unicode-tricks,Hybrid chess pieces can only be rendered in   and  . unicode-tricksHybrid chess pieces like the  knight-queen,  knight-rook and  knight-bishop. unicode-tricksThe  knight-queen chess piece. unicode-tricksThe  knight-rook chess piece. unicode-tricksThe  knight-bishop chess piece. unicode-tricks>Extra rotations that can be performed for knight chess pieces. unicode-tricksRotation over 45 degrees. unicode-tricksRotation over 135 degrees. unicode-tricksRotation over 225 degrees. unicode-tricksRotation over 315 degrees. unicode-tricks.The type of chess pieces. Unicode includes an   as piece as well. unicode-tricksThe king chess piece. unicode-tricksThe queen chess piece. unicode-tricksThe rook chess piece. unicode-tricksThe bishop chess piece. unicode-tricksThe knight chess piece. unicode-tricksThe pawn chess piece. unicode-tricksThe  equihopper chess piece. unicode-tricks8The color of a chess piece, this can for most pieces be  ,  , or  . unicode-tricksWhite color. unicode-tricksBlack color. unicode-tricks.Neutral chess pieces, sometimes depicted half white and half black. unicode-tricks(A data type that defined binary colors ( , and  1), this is used for special chess pieces like a  knight queen,  knight rook, and  knight bishop, that only have no neutral color in unicode. unicode-tricksWhite color. unicode-tricksBlack color. unicode-tricksA princess is alterative name for a  knight-bishop. unicode-tricksA cardinal is alterative name for a  knight-bishop. unicode-tricksAn empress is alterative name for a  knight-rook. unicode-tricksA marshall is alterative name for a  knight-rook. unicode-tricksA  chancellor is alterative name for a  knight-rook. unicode-tricksA  superqueen is alterative name for a  knight-queen. unicode-tricksAn omnipotent queen is alterative name for a  knight-queen. unicode-tricksA terror is alterative name for a  knight-queen. unicode-tricksAn amazon is alterative name for a  knight-queen. unicode-tricksA  Nightrider is a knight rotated over 180 degrees. unicode-tricksA  grasshopper is a queen rotated over 180 degrees. unicode-tricksConvert the given  ( to the corresponding unicode character. unicode-tricks The given   to convert.unicode-tricks0The unicode character that represents the given  .( ( 0Support to work with card characters in unicode.hapytexeu+gh@gmail.com experimentalPOSIXSafe unicode-tricksA data type that represents the possible types of cards for which there is a Unicode characters. This is the back of a card, a card with a suit and rank, three jokers , and the 21 trump cards and the fool. unicode-tricksThe back of the card. unicode-tricks"A card that is a combination of a   and a  . There are 56 possibilities. unicode-tricksThree possible   cards. unicode-tricks0A data type for the trump cards, often used for tarot. unicode-tricksThe fool6 trump card, this tarot card is normally not numbered. unicode-tricks Tarot card I. unicode-tricks Tarot card II. unicode-tricks Tarot card III. unicode-tricks Tarot card IV. unicode-tricks Tarot card V. unicode-tricks Tarot card VI. unicode-tricks Tarot card VII. unicode-tricks Tarot card VIII. unicode-tricks Tarot card IX. unicode-tricks Tarot card X. unicode-tricks Tarot card XI. unicode-tricks Tarot card XII. unicode-tricks Tarot card XIII. unicode-tricks Tarot card XIV. unicode-tricks Tarot card XV. unicode-tricks Tarot card XVI. unicode-tricks Tarot card XVII. unicode-tricks Tarot card XVIII. unicode-tricks Tarot card XIX. unicode-tricks Tarot card XX. unicode-tricks Tarot card XXI. unicode-tricksA data type to represent the three colors for which there are jokers: red, black and white. unicode-tricksThe red joker. unicode-tricksThe black joker. unicode-tricksThe white joker. unicode-tricks%A data type for the rank of the card. unicode-tricksThe ace card rank. unicode-tricks Card rank 2. unicode-tricks Card rank 3. unicode-tricks Card rank 4. unicode-tricks Card rank 5. unicode-tricks Card rank 6. unicode-tricks Card rank 7. unicode-tricks Card rank 8. unicode-tricks Card rank 9. unicode-tricks Card rank 10. unicode-tricksThe jack card rank. unicode-tricksThe knight card rank. unicode-tricksThe queen card rank. unicode-tricksThe king card rank. unicode-tricksA data type for the card suits unicode-tricksThe spades card suit. unicode-tricksThe hearts card suit. unicode-tricksThe diamonds card suit. unicode-tricksThe clubs card suit. unicode-tricksThe trump card with number XXI is named  collective. unicode-tricksThe trump card with number XX is named the game. unicode-tricksThe trump card with number XIX is named winter. unicode-tricksThe trump card with number XVIII is named autumn. unicode-tricksThe trump card with number XVII is named summer. unicode-tricksThe trump card with number XVI is named spring. unicode-tricksThe trump card with number XV is named  visual arts. unicode-tricksThe trump card with number XIV is named open air. unicode-tricksThe trump card with number XIII is named shopping. unicode-tricksThe trump card with number XII is named dance. unicode-tricksThe trump card with number XI is named fire. unicode-tricksThe trump card with number XI is named water. unicode-tricksThe trump card with number X is named air. unicode-tricksThe trump card with number X is named earth. unicode-tricksThe trump card with number IX is named night. unicode-tricksThe trump card with number VIII is named evening. unicode-tricksThe trump card with number VII is named  afternoon. unicode-tricksThe trump card with number VI is named morning. unicode-tricksThe trump card with number V is named old age. unicode-tricksThe trump card with number IV is named maturity. unicode-tricksThe trump card with number III is named youth. unicode-tricksThe trump card with number II is named  childhood. unicode-tricksThe trump card with number I is named  individual. unicode-tricksIn Italy, the queen is sometimes called the re. unicode-tricksIn Germany, the king is sometimes called the knig. unicode-tricksIn France, the king is sometimes called the roi. unicode-tricksIn Italy, the queen is sometimes called the regina. unicode-tricksIn Germany, the queen is sometimes called the knigin. unicode-tricksAn alternative name for the queen is dame. unicode-tricksAn alternative name for the jack is  cavaliere. unicode-tricksAn alternative name for the jack is cavall. unicode-tricksIn Germany, the knight is sometimes called the ritter. unicode-tricksIn Germany, the knight is sometimes called the ober. unicode-tricksIn France, the knight is sometimes called the  chevalier. unicode-tricksIn Italy, the jack is sometimes called the fante. unicode-tricksAn alternative name for the jack is page. unicode-tricks In Germany and Switzerland, the jack is sometimes called the unter. unicode-tricks)In Germany, Austria and Switzerland, the jack is sometimes called the bube. unicode-tricksIn France, the jack is sometimes called the valet. unicode-tricksWands is an alias for the clubs card suit. unicode-tricks Pentacles is an alias for the diamonds card suit. unicode-tricksCups is an alias for the hearts card suit. unicode-tricksSwords is an alias for the spades card suit. unicode-tricks*The unicode character that represents the back of the card. unicode-tricksConvert the given   and  4 to the equivalent unicode character for this card. unicode-tricksConvert the given  = to the unicode character which represents this joker color. unicode-tricks unicode-tricksA data type that determines the state of the four subparts of the block. unicode-tricksThe upper part of the block. unicode-tricksThe lower part of the block. unicode-tricks-A data type that determines the state of the row in a block. it determines the left and the right part of the row of the block. unicode-tricks$The left part of a row of the block. unicode-tricks'The right part of the row of the block. unicode-tricksConvert the given  acter to a   of s wrapped in a  if it exists;  otherwise. unicode-tricksConvert the given  acter to a   of -s if it exists; unspecified result otherwise. unicode-tricksConvert the given  ) value to a block character in unicode.  means that part is filled, and  means the part is not filled. unicode-tricks The given acter to convert to a   of s. unicode-tricks The given acter to convert to a   of s.unicode-tricksThe equivalent   of s. unicode-tricks The given   of s to convert to a acter.unicode-tricksThe equivalent Unicode acter for the given   of s. 6A module used to render Braille characters in unicode.hapytexeu+gh@gmail.com experimentalPOSIXSafe567>Ă unicode-tricksA datastructure to render Braille patterns with eight dots cells. unicode-tricks2The state of the top row of the Braille character. unicode-tricks5The state of the second row of the Braille character. unicode-tricks4The state of the third row of the Braille character. unicode-tricks5The state of the bottom row of the Braille character. unicode-tricks?A datastructure to render Braille patterns with six dots cells. unicode-tricks2The state of the top row of the Braille character. unicode-tricks5The state of the middle row of the Braille character. unicode-tricks5The state of the bottom row of the Braille character. unicode-tricks Convert a   value to a   character, by putting in a given value at the two values at the bottom row. unicode-tricks Convert a   value to a  / character by setting the bottom row with two  values. unicode-tricksConvert the given  acter to a   object of $s. If the given character is not a Braille& character, the result is unspecified. unicode-tricksConvert the given  acter to a   object of $s. If the given character is not a Braille character, or a Braille character where the lowest row contains filled dots, then the result is unspecified. unicode-tricksConvert the given  acter to a   object of s wrapped in a ". If the given character is not a Braille character,  is returned. unicode-tricksConvert the given  acter to a   object of s wrapped in a ". If the given character is not a Braille character, or a Braille7 character where the lowest row contains filled dots,  is returned. unicode-tricksConvert the given  ? value to a unicode character representing this Braille value. unicode-tricksConvert the given  ? value to a unicode character representing this braille value. unicode-tricks0The value to put in the cells of the bottom row.unicode-tricks The given   value to convert.unicode-tricksA  ? value that uses as bottom two values given as first parameter. unicode-tricks The given   value to convert.unicode-tricksA  % value that uses as bottom two times . unicode-tricks The given acter to convert.unicode-tricksThe corresponding   object of s. unicode-tricks The given acter to convert.unicode-tricksThe corresponding   object of s. unicode-tricks The given acter to convert.unicode-tricksThe equivalent   object of s wrapped in a  if it exists;  otherwise. unicode-tricks The given acter to convert.unicode-tricksThe equivalent   object of s wrapped in a  if it exists;  otherwise.  1Support for the ballot box characters in unicode.hapytexeu+gh@gmail.com experimentalPOSIXSafenunicode-tricks?A datatype that represents the different types of ballot boxes.unicode-tricks The box is empty, this is represented with L.unicode-tricksThe box has a check, this is represented with L.unicode-tricksThe box has a cross, this is represented with L.unicode-tricksConvert the given  ean to a  that is , or contains a .unicode-tricksConvert the given  ean to a  that is , or contains a .unicode-tricks The given ' that determines if the box contains a .unicode-tricksThe corresponding .unicode-tricks The given ' that determines if the box contains a .unicode-tricksThe corresponding . 'Support for dice characters in unicode.hapytexeu+gh@gmail.com experimentalPOSIXSafep unicode-tricks)A data type to store the values of a die.unicode-tricksA die with value one, represented with M.unicode-tricksA die with value two, represented with M.unicode-tricksA die with value three, represented with M.unicode-tricksA die with value four, represented with M.unicode-tricksA die with value five, represented with M.unicode-tricksA die with value six, represented with M.unicode-tricks&Convert the given integral value to a  that represents the given number. If the number is less than one, or greater than six,  is returned.unicode-tricksConvert the given * to a unicode character that represents a die with that value.unicode-tricks)The given integral value to convert to a .unicode-tricksA  wrapped in a  if the given integral value is greater than zero, and less than seven, otherwise .unicode-tricksThe die value to convert.unicode-tricks9A unicode character that represents a die with the given .   A module that defines domino values, and their unicode equivalent.hapytexeu+gh@gmail.com experimentalPOSIXSafe567>Sunicode-tricksA  is a  that contains  values wrapping a . In case of a , that side is considered empty.unicode-tricksA  is a  that contains 1 objects, it thus can not have an "empty" value.unicode-tricks!A type alias that specifies that  is an F type that wraps a  item.unicode-tricksA domino piece, which has two items. Depending on the orientation, the items are located at the top and bottom; or left and right.unicode-tricks#The front side of the domino piece.unicode-tricks"The back side of the domino piece.unicode-tricks The part that is located at the left# side in case the piece is located  horizontally , or at the top in case the piece is located  vertically.unicode-tricks The part that is located at the right# side in case the piece is located  horizontally , or at the bottom in case the piece is located  vertically.unicode-tricksA pattern synonym that makes it more convenient to write expressions that look like domino's like for example II :| IV.unicode-tricksConvert the given  acter to an F  object. If the given acter is not a valid domino character, the result is unspecified.unicode-tricksConvert the given  acter to an F  object. If the given acter wrapped in a  data constructor if the .acter is a valid domino character; otherwise .unicode-tricks Convert a : value to a unicode character rendering the domino value  horizontally.unicode-tricks Convert a : value to a unicode character rendering the domino value  horizontally.unicode-tricks Convert a : value to a unicode character rendering the domino value  vertically.unicode-tricks Convert a : value to a unicode character rendering the domino value  vertically.unicode-tricks Convert an  to its unicode equivalent, where the sides of the domino can be empty.unicode-tricks Convert an ? to its unicode equivalent, where the sides of the domino can not be empty. unicode-tricks1The item that is located at the left, or the top.unicode-tricks5The item that is located at the right, or the bottom.unicode-tricksThe domino that is constructed.unicode-tricks The given acter to convert to an F  object.unicode-tricksThe equivalent F  object for the given acter.unicode-tricks The given acter to convert to an F  object.unicode-tricksThe equivalent F  object for the given acter wrapped in a ; , if the character is not a domino character.unicode-tricksThe  object to render horizontally.unicode-tricks0The unicode character that represents the given  value in a horizontal manner.unicode-tricksThe  object to render horizontally.unicode-tricks0The unicode character that represents the given  value in a horizontal manner.unicode-tricksThe  object to render vertically.unicode-tricks0The unicode character that represents the given  value in a vertical manner.unicode-tricksThe  object to render vertically.unicode-tricks0The unicode character that represents the given  value in vertical manner.unicode-tricksThe  to render.unicode-tricks+The unicode characters that represents the  value.unicode-tricksThe  to render.unicode-tricks+The unicode characters that represents the  value. A module that defines pattern synonyms for the 1099 hieroglyphs in Unicode.hapytexeu+gh@gmail.com experimentalPOSIXSafe%¯unicode-tricksThe Egyptian hieroglyph AA032 that renders as .unicode-tricksThe Egyptian hieroglyph AA031 that renders as .unicode-tricksThe Egyptian hieroglyph AA030 that renders as .unicode-tricksThe Egyptian hieroglyph AA029 that renders as .unicode-tricksThe Egyptian hieroglyph AA028 that renders as .unicode-tricksThe Egyptian hieroglyph AA027 that renders as .unicode-tricksThe Egyptian hieroglyph AA026 that renders as .unicode-tricksThe Egyptian hieroglyph AA025 that renders as .unicode-tricksThe Egyptian hieroglyph AA024 that renders as .unicode-tricksThe Egyptian hieroglyph AA023 that renders as .unicode-tricksThe Egyptian hieroglyph AA022 that renders as .unicode-tricksThe Egyptian hieroglyph AA021 that renders as .unicode-tricksThe Egyptian hieroglyph AA020 that renders as .unicode-tricksThe Egyptian hieroglyph AA019 that renders as .unicode-tricksThe Egyptian hieroglyph AA018 that renders as .unicode-tricksThe Egyptian hieroglyph AA017 that renders as .unicode-tricksThe Egyptian hieroglyph AA016 that renders as .unicode-tricksThe Egyptian hieroglyph AA015 that renders as .unicode-tricksThe Egyptian hieroglyph AA014 that renders as .unicode-tricksThe Egyptian hieroglyph AA013 that renders as .unicode-tricksThe Egyptian hieroglyph AA012 that renders as .unicode-tricksThe Egyptian hieroglyph AA011 that renders as .unicode-tricksThe Egyptian hieroglyph AA010 that renders as .unicode-tricksThe Egyptian hieroglyph AA009 that renders as .unicode-tricksThe Egyptian hieroglyph AA008 that renders as .unicode-tricksThe Egyptian hieroglyph AA007B that renders as .unicode-tricksThe Egyptian hieroglyph AA007A that renders as .unicode-tricksThe Egyptian hieroglyph AA007 that renders as .unicode-tricksThe Egyptian hieroglyph AA006 that renders as .unicode-tricksThe Egyptian hieroglyph AA005 that renders as .unicode-tricksThe Egyptian hieroglyph AA004 that renders as .unicode-tricksThe Egyptian hieroglyph AA003 that renders as .unicode-tricksThe Egyptian hieroglyph AA002 that renders as .unicode-tricksThe Egyptian hieroglyph AA001 that renders as .unicode-tricksThe Egyptian hieroglyph Z016H that renders as .unicode-tricksThe Egyptian hieroglyph Z016G that renders as .unicode-tricksThe Egyptian hieroglyph Z016F that renders as .unicode-tricksThe Egyptian hieroglyph Z016E that renders as .unicode-tricksThe Egyptian hieroglyph Z016D that renders as .unicode-tricksThe Egyptian hieroglyph Z016C that renders as .unicode-tricksThe Egyptian hieroglyph Z016B that renders as .unicode-tricksThe Egyptian hieroglyph Z016A that renders as .unicode-tricksThe Egyptian hieroglyph Z016 that renders as .unicode-tricksThe Egyptian hieroglyph Z015I that renders as .unicode-tricksThe Egyptian hieroglyph Z015H that renders as .unicode-tricksThe Egyptian hieroglyph Z015G that renders as .unicode-tricksThe Egyptian hieroglyph Z015F that renders as .unicode-tricksThe Egyptian hieroglyph Z015E that renders as .unicode-tricksThe Egyptian hieroglyph Z015D that renders as .unicode-tricksThe Egyptian hieroglyph Z015C that renders as .unicode-tricksThe Egyptian hieroglyph Z015B that renders as .unicode-tricksThe Egyptian hieroglyph Z015A that renders as .unicode-tricksThe Egyptian hieroglyph Z015 that renders as .unicode-tricksThe Egyptian hieroglyph Z014 that renders as .unicode-tricksThe Egyptian hieroglyph Z013 that renders as .unicode-tricksThe Egyptian hieroglyph Z012 that renders as .unicode-tricksThe Egyptian hieroglyph Z011 that renders as .unicode-tricksThe Egyptian hieroglyph Z010 that renders as .unicode-tricksThe Egyptian hieroglyph Z009 that renders as .unicode-tricksThe Egyptian hieroglyph Z008 that renders as .unicode-tricksThe Egyptian hieroglyph Z007 that renders as .unicode-tricksThe Egyptian hieroglyph Z006 that renders as .unicode-tricksThe Egyptian hieroglyph Z005A that renders as .unicode-tricksThe Egyptian hieroglyph Z005 that renders as .unicode-tricksThe Egyptian hieroglyph Z004A that renders as .unicode-tricksThe Egyptian hieroglyph Z004 that renders as .unicode-tricksThe Egyptian hieroglyph Z003B that renders as .unicode-tricksThe Egyptian hieroglyph Z003A that renders as .unicode-tricksThe Egyptian hieroglyph Z003 that renders as .unicode-tricksThe Egyptian hieroglyph Z002D that renders as .unicode-tricksThe Egyptian hieroglyph Z002C that renders as .unicode-tricksThe Egyptian hieroglyph Z002B that renders as .unicode-tricksThe Egyptian hieroglyph Z002A that renders as .unicode-tricksThe Egyptian hieroglyph Z002 that renders as .unicode-tricksThe Egyptian hieroglyph Z001 that renders as .unicode-tricksThe Egyptian hieroglyph Y008 that renders as .unicode-tricksThe Egyptian hieroglyph Y007 that renders as .unicode-tricksThe Egyptian hieroglyph Y006 that renders as .unicode-tricksThe Egyptian hieroglyph Y005 that renders as .unicode-tricksThe Egyptian hieroglyph Y004 that renders as .unicode-tricksThe Egyptian hieroglyph Y003 that renders as .unicode-tricksThe Egyptian hieroglyph Y002 that renders as .unicode-tricksThe Egyptian hieroglyph Y001A that renders as .unicode-tricksThe Egyptian hieroglyph Y001 that renders as .unicode-tricksThe Egyptian hieroglyph X008A that renders as .unicode-tricksThe Egyptian hieroglyph X008 that renders as .unicode-tricksThe Egyptian hieroglyph X007 that renders as .unicode-tricksThe Egyptian hieroglyph X006A that renders as .unicode-tricksThe Egyptian hieroglyph X006 that renders as .unicode-tricksThe Egyptian hieroglyph X005 that renders as .unicode-tricksThe Egyptian hieroglyph X004B that renders as .unicode-tricksThe Egyptian hieroglyph X004A that renders as .unicode-tricksThe Egyptian hieroglyph X004 that renders as .unicode-tricksThe Egyptian hieroglyph X003 that renders as .unicode-tricksThe Egyptian hieroglyph X002 that renders as .unicode-tricksThe Egyptian hieroglyph X001 that renders as .unicode-tricksThe Egyptian hieroglyph W025 that renders as .unicode-tricksThe Egyptian hieroglyph W024A that renders as .unicode-tricksThe Egyptian hieroglyph W024 that renders as .unicode-tricksThe Egyptian hieroglyph W023 that renders as .unicode-tricksThe Egyptian hieroglyph W022 that renders as .unicode-tricksThe Egyptian hieroglyph W021 that renders as .unicode-tricksThe Egyptian hieroglyph W020 that renders as .unicode-tricksThe Egyptian hieroglyph W019 that renders as .unicode-tricksThe Egyptian hieroglyph W018A that renders as .unicode-tricksThe Egyptian hieroglyph W018 that renders as .unicode-tricksThe Egyptian hieroglyph W017A that renders as .unicode-tricksThe Egyptian hieroglyph W017 that renders as .unicode-tricksThe Egyptian hieroglyph W016 that renders as .unicode-tricksThe Egyptian hieroglyph W015 that renders as .unicode-tricksThe Egyptian hieroglyph W014A that renders as .unicode-tricksThe Egyptian hieroglyph W014 that renders as .unicode-tricksThe Egyptian hieroglyph W013 that renders as .unicode-tricksThe Egyptian hieroglyph W012 that renders as .unicode-tricksThe Egyptian hieroglyph W011 that renders as .unicode-tricksThe Egyptian hieroglyph W010A that renders as .unicode-tricksThe Egyptian hieroglyph W010 that renders as .unicode-tricksThe Egyptian hieroglyph W009A that renders as .unicode-tricksThe Egyptian hieroglyph W009 that renders as .unicode-tricksThe Egyptian hieroglyph W008 that renders as .unicode-tricksThe Egyptian hieroglyph W007 that renders as .unicode-tricksThe Egyptian hieroglyph W006 that renders as .unicode-tricksThe Egyptian hieroglyph W005 that renders as .unicode-tricksThe Egyptian hieroglyph W004 that renders as .unicode-tricksThe Egyptian hieroglyph W003A that renders as .unicode-tricksThe Egyptian hieroglyph W003 that renders as .unicode-tricksThe Egyptian hieroglyph W002 that renders as .unicode-tricksThe Egyptian hieroglyph W001 that renders as .unicode-tricksThe Egyptian hieroglyph V040A that renders as .unicode-tricksThe Egyptian hieroglyph V040 that renders as .unicode-tricksThe Egyptian hieroglyph V039 that renders as .unicode-tricksThe Egyptian hieroglyph V038 that renders as .unicode-tricksThe Egyptian hieroglyph V037A that renders as .unicode-tricksThe Egyptian hieroglyph V037 that renders as .unicode-tricksThe Egyptian hieroglyph V036 that renders as .unicode-tricksThe Egyptian hieroglyph V035 that renders as .unicode-tricksThe Egyptian hieroglyph V034 that renders as .unicode-tricksThe Egyptian hieroglyph V033A that renders as .unicode-tricksThe Egyptian hieroglyph V033 that renders as .unicode-tricksThe Egyptian hieroglyph V032 that renders as .unicode-tricksThe Egyptian hieroglyph V031A that renders as .unicode-tricksThe Egyptian hieroglyph V031 that renders as .unicode-tricksThe Egyptian hieroglyph V030A that renders as .unicode-tricksThe Egyptian hieroglyph V030 that renders as .unicode-tricksThe Egyptian hieroglyph V029A that renders as .unicode-tricksThe Egyptian hieroglyph V029 that renders as .unicode-tricksThe Egyptian hieroglyph V028A that renders as .unicode-tricksThe Egyptian hieroglyph V028 that renders as .unicode-tricksThe Egyptian hieroglyph V027 that renders as .unicode-tricksThe Egyptian hieroglyph V026 that renders as .unicode-tricksThe Egyptian hieroglyph V025 that renders as .unicode-tricksThe Egyptian hieroglyph V024 that renders as .unicode-tricksThe Egyptian hieroglyph V023A that renders as .unicode-tricksThe Egyptian hieroglyph V023 that renders as .unicode-tricksThe Egyptian hieroglyph V022 that renders as .unicode-tricksThe Egyptian hieroglyph V021 that renders as .unicode-tricksThe Egyptian hieroglyph V020L that renders as .unicode-tricksThe Egyptian hieroglyph V020K that renders as .unicode-tricksThe Egyptian hieroglyph V020J that renders as .unicode-tricksThe Egyptian hieroglyph V020I that renders as .unicode-tricksThe Egyptian hieroglyph V020H that renders as .unicode-tricksThe Egyptian hieroglyph V020G that renders as .unicode-tricksThe Egyptian hieroglyph V020F that renders as .unicode-tricksThe Egyptian hieroglyph V020E that renders as .unicode-tricksThe Egyptian hieroglyph V020D that renders as .unicode-tricksThe Egyptian hieroglyph V020C that renders as .unicode-tricksThe Egyptian hieroglyph V020B that renders as .unicode-tricksThe Egyptian hieroglyph V020A that renders as .unicode-tricksThe Egyptian hieroglyph V020 that renders as .unicode-tricksThe Egyptian hieroglyph V019 that renders as .unicode-tricksThe Egyptian hieroglyph V018 that renders as .unicode-tricksThe Egyptian hieroglyph V017 that renders as .unicode-tricksThe Egyptian hieroglyph V016 that renders as .unicode-tricksThe Egyptian hieroglyph V015 that renders as .unicode-tricksThe Egyptian hieroglyph V014 that renders as .unicode-tricksThe Egyptian hieroglyph V013 that renders as .unicode-tricksThe Egyptian hieroglyph V012B that renders as .unicode-tricksThe Egyptian hieroglyph V012A that renders as .unicode-tricksThe Egyptian hieroglyph V012 that renders as .unicode-tricksThe Egyptian hieroglyph V011C that renders as .unicode-tricksThe Egyptian hieroglyph V011B that renders as .unicode-tricksThe Egyptian hieroglyph V011A that renders as .unicode-tricksThe Egyptian hieroglyph V011 that renders as .unicode-tricksThe Egyptian hieroglyph V010 that renders as .unicode-tricksThe Egyptian hieroglyph V009 that renders as .unicode-tricksThe Egyptian hieroglyph V008 that renders as .unicode-tricksThe Egyptian hieroglyph V007B that renders as .unicode-tricksThe Egyptian hieroglyph V007A that renders as .unicode-tricksThe Egyptian hieroglyph V007 that renders as .unicode-tricksThe Egyptian hieroglyph V006 that renders as .unicode-tricksThe Egyptian hieroglyph V005 that renders as .unicode-tricksThe Egyptian hieroglyph V004 that renders as .unicode-tricksThe Egyptian hieroglyph V003 that renders as .unicode-tricksThe Egyptian hieroglyph V002A that renders as .unicode-tricksThe Egyptian hieroglyph V002 that renders as .unicode-tricksThe Egyptian hieroglyph V001I that renders as .unicode-tricksThe Egyptian hieroglyph V001H that renders as .unicode-tricksThe Egyptian hieroglyph V001G that renders as .unicode-tricksThe Egyptian hieroglyph V001F that renders as .unicode-tricksThe Egyptian hieroglyph V001E that renders as .unicode-tricksThe Egyptian hieroglyph V001D that renders as .unicode-tricksThe Egyptian hieroglyph V001C that renders as .unicode-tricksThe Egyptian hieroglyph V001B that renders as .unicode-tricksThe Egyptian hieroglyph V001A that renders as .unicode-tricksThe Egyptian hieroglyph V001 that renders as .unicode-tricksThe Egyptian hieroglyph U042 that renders as .unicode-tricksThe Egyptian hieroglyph U041 that renders as .unicode-tricksThe Egyptian hieroglyph U040 that renders as .unicode-tricksThe Egyptian hieroglyph U039 that renders as .unicode-tricksThe Egyptian hieroglyph U038 that renders as .unicode-tricksThe Egyptian hieroglyph U037 that renders as .unicode-tricksThe Egyptian hieroglyph U036 that renders as .unicode-tricksThe Egyptian hieroglyph U035 that renders as .unicode-tricksThe Egyptian hieroglyph U034 that renders as .unicode-tricksThe Egyptian hieroglyph U033 that renders as .unicode-tricksThe Egyptian hieroglyph U032A that renders as .unicode-tricksThe Egyptian hieroglyph U032 that renders as .unicode-tricksThe Egyptian hieroglyph U031 that renders as .unicode-tricksThe Egyptian hieroglyph U030 that renders as .unicode-tricksThe Egyptian hieroglyph U029A that renders as .unicode-tricksThe Egyptian hieroglyph U029 that renders as .unicode-tricksThe Egyptian hieroglyph U028 that renders as .unicode-tricksThe Egyptian hieroglyph U027 that renders as .unicode-tricksThe Egyptian hieroglyph U026 that renders as .unicode-tricksThe Egyptian hieroglyph U025 that renders as .unicode-tricksThe Egyptian hieroglyph U024 that renders as .unicode-tricksThe Egyptian hieroglyph U023A that renders as .unicode-tricksThe Egyptian hieroglyph U023 that renders as .unicode-tricksThe Egyptian hieroglyph U022 that renders as .unicode-tricksThe Egyptian hieroglyph U021 that renders as .unicode-tricksThe Egyptian hieroglyph U020 that renders as .unicode-tricksThe Egyptian hieroglyph U019 that renders as .unicode-tricksThe Egyptian hieroglyph U018 that renders as .unicode-tricksThe Egyptian hieroglyph U017 that renders as .unicode-tricksThe Egyptian hieroglyph U016 that renders as .unicode-tricksThe Egyptian hieroglyph U015 that renders as .unicode-tricksThe Egyptian hieroglyph U014 that renders as .unicode-tricksThe Egyptian hieroglyph U013 that renders as .unicode-tricksThe Egyptian hieroglyph U012 that renders as .unicode-tricksThe Egyptian hieroglyph U011 that renders as .unicode-tricksThe Egyptian hieroglyph U010 that renders as .unicode-tricksThe Egyptian hieroglyph U009 that renders as .unicode-tricksThe Egyptian hieroglyph U008 that renders as .unicode-tricksThe Egyptian hieroglyph U007 that renders as .unicode-tricksThe Egyptian hieroglyph U006B that renders as .unicode-tricksThe Egyptian hieroglyph U006A that renders as .unicode-tricksThe Egyptian hieroglyph U006 that renders as .unicode-tricksThe Egyptian hieroglyph U005 that renders as .unicode-tricksThe Egyptian hieroglyph U004 that renders as .unicode-tricksThe Egyptian hieroglyph U003 that renders as .unicode-tricksThe Egyptian hieroglyph U002 that renders as .unicode-tricksThe Egyptian hieroglyph U001 that renders as .unicode-tricksThe Egyptian hieroglyph T036 that renders as .unicode-tricksThe Egyptian hieroglyph T035 that renders as .unicode-tricksThe Egyptian hieroglyph T034 that renders as .unicode-tricksThe Egyptian hieroglyph T033A that renders as .unicode-tricksThe Egyptian hieroglyph T033 that renders as .unicode-tricksThe Egyptian hieroglyph T032A that renders as .unicode-tricksThe Egyptian hieroglyph T032 that renders as .unicode-tricksThe Egyptian hieroglyph T031 that renders as .unicode-tricksThe Egyptian hieroglyph T030 that renders as .unicode-tricksThe Egyptian hieroglyph T029 that renders as .unicode-tricksThe Egyptian hieroglyph T028 that renders as .unicode-tricksThe Egyptian hieroglyph T027 that renders as .unicode-tricksThe Egyptian hieroglyph T026 that renders as .unicode-tricksThe Egyptian hieroglyph T025 that renders as .unicode-tricksThe Egyptian hieroglyph T024 that renders as .unicode-tricksThe Egyptian hieroglyph T023 that renders as .unicode-tricksThe Egyptian hieroglyph T022 that renders as .unicode-tricksThe Egyptian hieroglyph T021 that renders as .unicode-tricksThe Egyptian hieroglyph T020 that renders as .unicode-tricksThe Egyptian hieroglyph T019 that renders as .unicode-tricksThe Egyptian hieroglyph T018 that renders as .unicode-tricksThe Egyptian hieroglyph T017 that renders as .unicode-tricksThe Egyptian hieroglyph T016A that renders as .unicode-tricksThe Egyptian hieroglyph T016 that renders as .unicode-tricksThe Egyptian hieroglyph T015 that renders as .unicode-tricksThe Egyptian hieroglyph T014 that renders as .unicode-tricksThe Egyptian hieroglyph T013 that renders as .unicode-tricksThe Egyptian hieroglyph T012 that renders as .unicode-tricksThe Egyptian hieroglyph T011A that renders as .unicode-tricksThe Egyptian hieroglyph T011 that renders as .unicode-tricksThe Egyptian hieroglyph T010 that renders as .unicode-tricksThe Egyptian hieroglyph T009A that renders as .unicode-tricksThe Egyptian hieroglyph T009 that renders as .unicode-tricksThe Egyptian hieroglyph T008A that renders as .unicode-tricksThe Egyptian hieroglyph T008 that renders as .unicode-tricksThe Egyptian hieroglyph T007A that renders as .unicode-tricksThe Egyptian hieroglyph T007 that renders as .unicode-tricksThe Egyptian hieroglyph T006 that renders as .unicode-tricksThe Egyptian hieroglyph T005 that renders as .unicode-tricksThe Egyptian hieroglyph T004 that renders as .unicode-tricksThe Egyptian hieroglyph T003A that renders as .unicode-tricksThe Egyptian hieroglyph T003 that renders as .unicode-tricksThe Egyptian hieroglyph T002 that renders as .unicode-tricksThe Egyptian hieroglyph T001 that renders as .unicode-tricksThe Egyptian hieroglyph S046 that renders as .unicode-tricksThe Egyptian hieroglyph S045 that renders as .unicode-tricksThe Egyptian hieroglyph S044 that renders as .unicode-tricksThe Egyptian hieroglyph S043 that renders as .unicode-tricksThe Egyptian hieroglyph S042 that renders as .unicode-tricksThe Egyptian hieroglyph S041 that renders as .unicode-tricksThe Egyptian hieroglyph S040 that renders as .unicode-tricksThe Egyptian hieroglyph S039 that renders as .unicode-tricksThe Egyptian hieroglyph S038 that renders as .unicode-tricksThe Egyptian hieroglyph S037 that renders as .unicode-tricksThe Egyptian hieroglyph S036 that renders as .unicode-tricksThe Egyptian hieroglyph S035A that renders as .unicode-tricksThe Egyptian hieroglyph S035 that renders as .unicode-tricksThe Egyptian hieroglyph S034 that renders as .unicode-tricksThe Egyptian hieroglyph S033 that renders as .unicode-tricksThe Egyptian hieroglyph S032 that renders as .unicode-tricksThe Egyptian hieroglyph S031 that renders as .unicode-tricksThe Egyptian hieroglyph S030 that renders as .unicode-tricksThe Egyptian hieroglyph S029 that renders as .unicode-tricksThe Egyptian hieroglyph S028 that renders as .unicode-tricksThe Egyptian hieroglyph S027 that renders as .unicode-tricksThe Egyptian hieroglyph S026B that renders as .unicode-tricksThe Egyptian hieroglyph S026A that renders as .unicode-tricksThe Egyptian hieroglyph S026 that renders as .unicode-tricksThe Egyptian hieroglyph S025 that renders as .unicode-tricksThe Egyptian hieroglyph S024 that renders as .unicode-tricksThe Egyptian hieroglyph S023 that renders as .unicode-tricksThe Egyptian hieroglyph S022 that renders as .unicode-tricksThe Egyptian hieroglyph S021 that renders as .unicode-tricksThe Egyptian hieroglyph S020 that renders as .unicode-tricksThe Egyptian hieroglyph S019 that renders as .unicode-tricksThe Egyptian hieroglyph S018 that renders as .unicode-tricksThe Egyptian hieroglyph S017A that renders as .unicode-tricksThe Egyptian hieroglyph S017 that renders as .unicode-tricksThe Egyptian hieroglyph S016 that renders as .unicode-tricksThe Egyptian hieroglyph S015 that renders as .unicode-tricksThe Egyptian hieroglyph S014B that renders as .unicode-tricksThe Egyptian hieroglyph S014A that renders as .unicode-tricksThe Egyptian hieroglyph S014 that renders as .unicode-tricksThe Egyptian hieroglyph S013 that renders as .unicode-tricksThe Egyptian hieroglyph S012 that renders as .unicode-tricksThe Egyptian hieroglyph S011 that renders as .unicode-tricksThe Egyptian hieroglyph S010 that renders as .unicode-tricksThe Egyptian hieroglyph S009 that renders as .unicode-tricksThe Egyptian hieroglyph S008 that renders as .unicode-tricksThe Egyptian hieroglyph S007 that renders as .unicode-tricksThe Egyptian hieroglyph S006A that renders as .unicode-tricksThe Egyptian hieroglyph S006 that renders as .unicode-tricksThe Egyptian hieroglyph S005 that renders as .unicode-tricksThe Egyptian hieroglyph S004 that renders as .unicode-tricksThe Egyptian hieroglyph S003 that renders as .unicode-tricksThe Egyptian hieroglyph S002A that renders as .unicode-tricksThe Egyptian hieroglyph S002 that renders as .unicode-tricksThe Egyptian hieroglyph S001 that renders as .unicode-tricksThe Egyptian hieroglyph R029 that renders as .unicode-tricksThe Egyptian hieroglyph R028 that renders as .unicode-tricksThe Egyptian hieroglyph R027 that renders as .unicode-tricksThe Egyptian hieroglyph R026 that renders as .unicode-tricksThe Egyptian hieroglyph R025 that renders as .unicode-tricksThe Egyptian hieroglyph R024 that renders as .unicode-tricksThe Egyptian hieroglyph R023 that renders as .unicode-tricksThe Egyptian hieroglyph R022 that renders as .unicode-tricksThe Egyptian hieroglyph R021 that renders as .unicode-tricksThe Egyptian hieroglyph R020 that renders as .unicode-tricksThe Egyptian hieroglyph R019 that renders as .unicode-tricksThe Egyptian hieroglyph R018 that renders as .unicode-tricksThe Egyptian hieroglyph R017 that renders as .unicode-tricksThe Egyptian hieroglyph R016A that renders as .unicode-tricksThe Egyptian hieroglyph R016 that renders as .unicode-tricksThe Egyptian hieroglyph R015 that renders as .unicode-tricksThe Egyptian hieroglyph R014 that renders as .unicode-tricksThe Egyptian hieroglyph R013 that renders as .unicode-tricksThe Egyptian hieroglyph R012 that renders as .unicode-tricksThe Egyptian hieroglyph R011 that renders as .unicode-tricksThe Egyptian hieroglyph R010A that renders as .unicode-tricksThe Egyptian hieroglyph R010 that renders as .unicode-tricksThe Egyptian hieroglyph R009 that renders as .unicode-tricksThe Egyptian hieroglyph R008 that renders as .unicode-tricksThe Egyptian hieroglyph R007 that renders as .unicode-tricksThe Egyptian hieroglyph R006 that renders as .unicode-tricksThe Egyptian hieroglyph R005 that renders as .unicode-tricksThe Egyptian hieroglyph R004 that renders as .unicode-tricksThe Egyptian hieroglyph R003B that renders as .unicode-tricksThe Egyptian hieroglyph R003A that renders as .unicode-tricksThe Egyptian hieroglyph R003 that renders as .unicode-tricksThe Egyptian hieroglyph R002A that renders as .unicode-tricksThe Egyptian hieroglyph R002 that renders as .unicode-tricksThe Egyptian hieroglyph R001 that renders as .unicode-tricksThe Egyptian hieroglyph Q007 that renders as .unicode-tricksThe Egyptian hieroglyph Q006 that renders as .unicode-tricksThe Egyptian hieroglyph Q005 that renders as .unicode-tricksThe Egyptian hieroglyph Q004 that renders as .unicode-tricksThe Egyptian hieroglyph Q003 that renders as .unicode-tricksThe Egyptian hieroglyph Q002 that renders as .unicode-tricksThe Egyptian hieroglyph Q001 that renders as .unicode-tricksThe Egyptian hieroglyph P011 that renders as .unicode-tricksThe Egyptian hieroglyph P010 that renders as .unicode-tricksThe Egyptian hieroglyph P009 that renders as .unicode-tricksThe Egyptian hieroglyph P008 that renders as .unicode-tricksThe Egyptian hieroglyph P007 that renders as .unicode-tricksThe Egyptian hieroglyph P006 that renders as .unicode-tricksThe Egyptian hieroglyph P005 that renders as .unicode-tricksThe Egyptian hieroglyph P004 that renders as .unicode-tricksThe Egyptian hieroglyph P003A that renders as .unicode-tricksThe Egyptian hieroglyph P003 that renders as .unicode-tricksThe Egyptian hieroglyph P002 that renders as .unicode-tricksThe Egyptian hieroglyph P001A that renders as .unicode-tricksThe Egyptian hieroglyph P001 that renders as .unicode-tricksThe Egyptian hieroglyph O051 that renders as .unicode-tricksThe Egyptian hieroglyph O050B that renders as .unicode-tricksThe Egyptian hieroglyph O050A that renders as .unicode-tricksThe Egyptian hieroglyph O050 that renders as .unicode-tricksThe Egyptian hieroglyph O049 that renders as .unicode-tricksThe Egyptian hieroglyph O048 that renders as .unicode-tricksThe Egyptian hieroglyph O047 that renders as .unicode-tricksThe Egyptian hieroglyph O046 that renders as .unicode-tricksThe Egyptian hieroglyph O045 that renders as .unicode-tricksThe Egyptian hieroglyph O044 that renders as .unicode-tricksThe Egyptian hieroglyph O043 that renders as .unicode-tricksThe Egyptian hieroglyph O042 that renders as .unicode-tricksThe Egyptian hieroglyph O041 that renders as .unicode-tricksThe Egyptian hieroglyph O040 that renders as .unicode-tricksThe Egyptian hieroglyph O039 that renders as .unicode-tricksThe Egyptian hieroglyph O038 that renders as .unicode-tricksThe Egyptian hieroglyph O037 that renders as .unicode-tricksThe Egyptian hieroglyph O036D that renders as .unicode-tricksThe Egyptian hieroglyph O036C that renders as .unicode-tricksThe Egyptian hieroglyph O036B that renders as .unicode-tricksThe Egyptian hieroglyph O036A that renders as .unicode-tricksThe Egyptian hieroglyph O036 that renders as .unicode-tricksThe Egyptian hieroglyph O035 that renders as .unicode-tricksThe Egyptian hieroglyph O034 that renders as .unicode-tricksThe Egyptian hieroglyph O033A that renders as .unicode-tricksThe Egyptian hieroglyph O033 that renders as .unicode-tricksThe Egyptian hieroglyph O032 that renders as .unicode-tricksThe Egyptian hieroglyph O031 that renders as .unicode-tricksThe Egyptian hieroglyph O030A that renders as .unicode-tricksThe Egyptian hieroglyph O030 that renders as .unicode-tricksThe Egyptian hieroglyph O029A that renders as .unicode-tricksThe Egyptian hieroglyph O029 that renders as .unicode-tricksThe Egyptian hieroglyph O028 that renders as .unicode-tricksThe Egyptian hieroglyph O027 that renders as .unicode-tricksThe Egyptian hieroglyph O026 that renders as .unicode-tricksThe Egyptian hieroglyph O025A that renders as .unicode-tricksThe Egyptian hieroglyph O025 that renders as .unicode-tricksThe Egyptian hieroglyph O024A that renders as .unicode-tricksThe Egyptian hieroglyph O024 that renders as .unicode-tricksThe Egyptian hieroglyph O023 that renders as .unicode-tricksThe Egyptian hieroglyph O022 that renders as .unicode-tricksThe Egyptian hieroglyph O021 that renders as .unicode-tricksThe Egyptian hieroglyph O020A that renders as .unicode-tricksThe Egyptian hieroglyph O020 that renders as .unicode-tricksThe Egyptian hieroglyph O019A that renders as .unicode-tricksThe Egyptian hieroglyph O019 that renders as .unicode-tricksThe Egyptian hieroglyph O018 that renders as .unicode-tricksThe Egyptian hieroglyph O017 that renders as .unicode-tricksThe Egyptian hieroglyph O016 that renders as .unicode-tricksThe Egyptian hieroglyph O015 that renders as .unicode-tricksThe Egyptian hieroglyph O014 that renders as .unicode-tricksThe Egyptian hieroglyph O013 that renders as .unicode-tricksThe Egyptian hieroglyph O012 that renders as .unicode-tricksThe Egyptian hieroglyph O011 that renders as .unicode-tricksThe Egyptian hieroglyph O010C that renders as .unicode-tricksThe Egyptian hieroglyph O010B that renders as .unicode-tricksThe Egyptian hieroglyph O010A that renders as .unicode-tricksThe Egyptian hieroglyph O010 that renders as .unicode-tricksThe Egyptian hieroglyph O009 that renders as .unicode-tricksThe Egyptian hieroglyph O008 that renders as .unicode-tricksThe Egyptian hieroglyph O007 that renders as .unicode-tricksThe Egyptian hieroglyph O006F that renders as .unicode-tricksThe Egyptian hieroglyph O006E that renders as .unicode-tricksThe Egyptian hieroglyph O006D that renders as .unicode-tricksThe Egyptian hieroglyph O006C that renders as .unicode-tricksThe Egyptian hieroglyph O006B that renders as .unicode-tricksThe Egyptian hieroglyph O006A that renders as .unicode-tricksThe Egyptian hieroglyph O006 that renders as .unicode-tricksThe Egyptian hieroglyph O005A that renders as .unicode-tricksThe Egyptian hieroglyph O005 that renders as .unicode-tricksThe Egyptian hieroglyph O004 that renders as .unicode-tricksThe Egyptian hieroglyph O003 that renders as .unicode-tricksThe Egyptian hieroglyph O002 that renders as .unicode-tricksThe Egyptian hieroglyph O001A that renders as .unicode-tricksThe Egyptian hieroglyph O001 that renders as .unicode-tricksThe Egyptian hieroglyph NU022A that renders as .unicode-tricksThe Egyptian hieroglyph NU022 that renders as .unicode-tricksThe Egyptian hieroglyph NU021 that renders as .unicode-tricksThe Egyptian hieroglyph NU020 that renders as .unicode-tricksThe Egyptian hieroglyph NU019 that renders as .unicode-tricksThe Egyptian hieroglyph NU018A that renders as .unicode-tricksThe Egyptian hieroglyph NU018 that renders as .unicode-tricksThe Egyptian hieroglyph NU017 that renders as .unicode-tricksThe Egyptian hieroglyph NU016 that renders as .unicode-tricksThe Egyptian hieroglyph NU015 that renders as .unicode-tricksThe Egyptian hieroglyph NU014 that renders as .unicode-tricksThe Egyptian hieroglyph NU013 that renders as .unicode-tricksThe Egyptian hieroglyph NU012 that renders as .unicode-tricksThe Egyptian hieroglyph NU011A that renders as .unicode-tricksThe Egyptian hieroglyph NU011 that renders as .unicode-tricksThe Egyptian hieroglyph NU010A that renders as .unicode-tricksThe Egyptian hieroglyph NU010 that renders as .unicode-tricksThe Egyptian hieroglyph NU009 that renders as .unicode-tricksThe Egyptian hieroglyph NU008 that renders as .unicode-tricksThe Egyptian hieroglyph NU007 that renders as .unicode-tricksThe Egyptian hieroglyph NU006 that renders as .unicode-tricksThe Egyptian hieroglyph NU005 that renders as .unicode-tricksThe Egyptian hieroglyph NU004 that renders as .unicode-tricksThe Egyptian hieroglyph NU003 that renders as .unicode-tricksThe Egyptian hieroglyph NU002 that renders as .unicode-tricksThe Egyptian hieroglyph NU001 that renders as .unicode-tricksThe Egyptian hieroglyph NL020 that renders as .unicode-tricksThe Egyptian hieroglyph NL019 that renders as .unicode-tricksThe Egyptian hieroglyph NL018 that renders as .unicode-tricksThe Egyptian hieroglyph NL017A that renders as .unicode-tricksThe Egyptian hieroglyph NL017 that renders as .unicode-tricksThe Egyptian hieroglyph NL016 that renders as .unicode-tricksThe Egyptian hieroglyph NL015 that renders as .unicode-tricksThe Egyptian hieroglyph NL014 that renders as .unicode-tricksThe Egyptian hieroglyph NL013 that renders as .unicode-tricksThe Egyptian hieroglyph NL012 that renders as .unicode-tricksThe Egyptian hieroglyph NL011 that renders as .unicode-tricksThe Egyptian hieroglyph NL010 that renders as .unicode-tricksThe Egyptian hieroglyph NL009 that renders as .unicode-tricksThe Egyptian hieroglyph NL008 that renders as .unicode-tricksThe Egyptian hieroglyph NL007 that renders as .unicode-tricksThe Egyptian hieroglyph NL006 that renders as .unicode-tricksThe Egyptian hieroglyph NL005A that renders as .unicode-tricksThe Egyptian hieroglyph NL005 that renders as .unicode-tricksThe Egyptian hieroglyph NL004 that renders as .unicode-tricksThe Egyptian hieroglyph NL003 that renders as .unicode-tricksThe Egyptian hieroglyph NL002 that renders as .unicode-tricksThe Egyptian hieroglyph NL001 that renders as .unicode-tricksThe Egyptian hieroglyph N042 that renders as .unicode-tricksThe Egyptian hieroglyph N041 that renders as .unicode-tricksThe Egyptian hieroglyph N040 that renders as .unicode-tricksThe Egyptian hieroglyph N039 that renders as .unicode-tricksThe Egyptian hieroglyph N038 that renders as .unicode-tricksThe Egyptian hieroglyph N037A that renders as .unicode-tricksThe Egyptian hieroglyph N037 that renders as .unicode-tricksThe Egyptian hieroglyph N036 that renders as .unicode-tricksThe Egyptian hieroglyph N035A that renders as .unicode-tricksThe Egyptian hieroglyph N035 that renders as .unicode-tricksThe Egyptian hieroglyph N034A that renders as .unicode-tricksThe Egyptian hieroglyph N034 that renders as .unicode-tricksThe Egyptian hieroglyph N033A that renders as .unicode-tricksThe Egyptian hieroglyph N033 that renders as .unicode-tricksThe Egyptian hieroglyph N032 that renders as .unicode-tricksThe Egyptian hieroglyph N031 that renders as .unicode-tricksThe Egyptian hieroglyph N030 that renders as .unicode-tricksThe Egyptian hieroglyph N029 that renders as .unicode-tricksThe Egyptian hieroglyph N028 that renders as .unicode-tricksThe Egyptian hieroglyph N027 that renders as .unicode-tricksThe Egyptian hieroglyph N026 that renders as .unicode-tricksThe Egyptian hieroglyph N025A that renders as .unicode-tricksThe Egyptian hieroglyph N025 that renders as .unicode-tricksThe Egyptian hieroglyph N024 that renders as .unicode-tricksThe Egyptian hieroglyph N023 that renders as .unicode-tricksThe Egyptian hieroglyph N022 that renders as .unicode-tricksThe Egyptian hieroglyph N021 that renders as .unicode-tricksThe Egyptian hieroglyph N020 that renders as .unicode-tricksThe Egyptian hieroglyph N019 that renders as .unicode-tricksThe Egyptian hieroglyph N018B that renders as .unicode-tricksThe Egyptian hieroglyph N018A that renders as .unicode-tricksThe Egyptian hieroglyph N018 that renders as .unicode-tricksThe Egyptian hieroglyph N017 that renders as .unicode-tricksThe Egyptian hieroglyph N016 that renders as .unicode-tricksThe Egyptian hieroglyph N015 that renders as .unicode-tricksThe Egyptian hieroglyph N014 that renders as .unicode-tricksThe Egyptian hieroglyph N013 that renders as .unicode-tricksThe Egyptian hieroglyph N012 that renders as .unicode-tricksThe Egyptian hieroglyph N011 that renders as .unicode-tricksThe Egyptian hieroglyph N010 that renders as .unicode-tricksThe Egyptian hieroglyph N009 that renders as .unicode-tricksThe Egyptian hieroglyph N008 that renders as .unicode-tricksThe Egyptian hieroglyph N007 that renders as .unicode-tricksThe Egyptian hieroglyph N006 that renders as .unicode-tricksThe Egyptian hieroglyph N005 that renders as .unicode-tricksThe Egyptian hieroglyph N004 that renders as .unicode-tricksThe Egyptian hieroglyph N003 that renders as .unicode-tricksThe Egyptian hieroglyph N002 that renders as .unicode-tricksThe Egyptian hieroglyph N001 that renders as .unicode-tricksThe Egyptian hieroglyph M044 that renders as .unicode-tricksThe Egyptian hieroglyph M043 that renders as .unicode-tricksThe Egyptian hieroglyph M042 that renders as .unicode-tricksThe Egyptian hieroglyph M041 that renders as .unicode-tricksThe Egyptian hieroglyph M040A that renders as .unicode-tricksThe Egyptian hieroglyph M040 that renders as .unicode-tricksThe Egyptian hieroglyph M039 that renders as .unicode-tricksThe Egyptian hieroglyph M038 that renders as .unicode-tricksThe Egyptian hieroglyph M037 that renders as .unicode-tricksThe Egyptian hieroglyph M036 that renders as .unicode-tricksThe Egyptian hieroglyph M035 that renders as .unicode-tricksThe Egyptian hieroglyph M034 that renders as .unicode-tricksThe Egyptian hieroglyph M033B that renders as .unicode-tricksThe Egyptian hieroglyph M033A that renders as .unicode-tricksThe Egyptian hieroglyph M033 that renders as .unicode-tricksThe Egyptian hieroglyph M032 that renders as .unicode-tricksThe Egyptian hieroglyph M031A that renders as .unicode-tricksThe Egyptian hieroglyph M031 that renders as .unicode-tricksThe Egyptian hieroglyph M030 that renders as .unicode-tricksThe Egyptian hieroglyph M029 that renders as .unicode-tricksThe Egyptian hieroglyph M028A that renders as .unicode-tricksThe Egyptian hieroglyph M028 that renders as .unicode-tricksThe Egyptian hieroglyph M027 that renders as .unicode-tricksThe Egyptian hieroglyph M026 that renders as .unicode-tricksThe Egyptian hieroglyph M025 that renders as .unicode-tricksThe Egyptian hieroglyph M024A that renders as .unicode-tricksThe Egyptian hieroglyph M024 that renders as .unicode-tricksThe Egyptian hieroglyph M023 that renders as .unicode-tricksThe Egyptian hieroglyph M022A that renders as .unicode-tricksThe Egyptian hieroglyph M022 that renders as .unicode-tricksThe Egyptian hieroglyph M021 that renders as .unicode-tricksThe Egyptian hieroglyph M020 that renders as .unicode-tricksThe Egyptian hieroglyph M019 that renders as .unicode-tricksThe Egyptian hieroglyph M018 that renders as .unicode-tricksThe Egyptian hieroglyph M017A that renders as .unicode-tricksThe Egyptian hieroglyph M017 that renders as .unicode-tricksThe Egyptian hieroglyph M016A that renders as .unicode-tricksThe Egyptian hieroglyph M016 that renders as .unicode-tricksThe Egyptian hieroglyph M015A that renders as .unicode-tricksThe Egyptian hieroglyph M015 that renders as .unicode-tricksThe Egyptian hieroglyph M014 that renders as .unicode-tricksThe Egyptian hieroglyph M013 that renders as .unicode-tricksThe Egyptian hieroglyph M012H that renders as .unicode-tricksThe Egyptian hieroglyph M012G that renders as .unicode-tricksThe Egyptian hieroglyph M012F that renders as .unicode-tricksThe Egyptian hieroglyph M012E that renders as .unicode-tricksThe Egyptian hieroglyph M012D that renders as .unicode-tricksThe Egyptian hieroglyph M012C that renders as .unicode-tricksThe Egyptian hieroglyph M012B that renders as .unicode-tricksThe Egyptian hieroglyph M012A that renders as .unicode-tricksThe Egyptian hieroglyph M012 that renders as .unicode-tricksThe Egyptian hieroglyph M011 that renders as .unicode-tricksThe Egyptian hieroglyph M010A that renders as .unicode-tricksThe Egyptian hieroglyph M010 that renders as .unicode-tricksThe Egyptian hieroglyph M009 that renders as .unicode-tricksThe Egyptian hieroglyph M008 that renders as .unicode-tricksThe Egyptian hieroglyph M007 that renders as .unicode-tricksThe Egyptian hieroglyph M006 that renders as .unicode-tricksThe Egyptian hieroglyph M005 that renders as .unicode-tricksThe Egyptian hieroglyph M004 that renders as .unicode-tricksThe Egyptian hieroglyph M003A that renders as .unicode-tricksThe Egyptian hieroglyph M003 that renders as .unicode-tricksThe Egyptian hieroglyph M002 that renders as .unicode-tricksThe Egyptian hieroglyph M001B that renders as .unicode-tricksThe Egyptian hieroglyph M001A that renders as .unicode-tricksThe Egyptian hieroglyph M001 that renders as .unicode-tricksThe Egyptian hieroglyph L008 that renders as .unicode-tricksThe Egyptian hieroglyph L007 that renders as .unicode-tricksThe Egyptian hieroglyph L006A that renders as .unicode-tricksThe Egyptian hieroglyph L006 that renders as .unicode-tricksThe Egyptian hieroglyph L005 that renders as .unicode-tricksThe Egyptian hieroglyph L004 that renders as .unicode-tricksThe Egyptian hieroglyph L003 that renders as .unicode-tricksThe Egyptian hieroglyph L002A that renders as .unicode-tricksThe Egyptian hieroglyph L002 that renders as .unicode-tricksThe Egyptian hieroglyph L001 that renders as .unicode-tricksThe Egyptian hieroglyph K008 that renders as .unicode-tricksThe Egyptian hieroglyph K007 that renders as .unicode-tricksThe Egyptian hieroglyph K006 that renders as .unicode-tricksThe Egyptian hieroglyph K005 that renders as .unicode-tricksThe Egyptian hieroglyph K004 that renders as .unicode-tricksThe Egyptian hieroglyph K003 that renders as .unicode-tricksThe Egyptian hieroglyph K002 that renders as .unicode-tricksThe Egyptian hieroglyph K001 that renders as .unicode-tricksThe Egyptian hieroglyph I015 that renders as .unicode-tricksThe Egyptian hieroglyph I014 that renders as .unicode-tricksThe Egyptian hieroglyph I013 that renders as .unicode-tricksThe Egyptian hieroglyph I012 that renders as .unicode-tricksThe Egyptian hieroglyph I011A that renders as .unicode-tricksThe Egyptian hieroglyph I011 that renders as .unicode-tricksThe Egyptian hieroglyph I010A that renders as .unicode-tricksThe Egyptian hieroglyph I010 that renders as .unicode-tricksThe Egyptian hieroglyph I009A that renders as .unicode-tricksThe Egyptian hieroglyph I009 that renders as .unicode-tricksThe Egyptian hieroglyph I008 that renders as .unicode-tricksThe Egyptian hieroglyph I007 that renders as .unicode-tricksThe Egyptian hieroglyph I006 that renders as .unicode-tricksThe Egyptian hieroglyph I005A that renders as .unicode-tricksThe Egyptian hieroglyph I005 that renders as .unicode-tricksThe Egyptian hieroglyph I004 that renders as .unicode-tricksThe Egyptian hieroglyph I003 that renders as .unicode-tricksThe Egyptian hieroglyph I002 that renders as .unicode-tricksThe Egyptian hieroglyph I001 that renders as .unicode-tricksThe Egyptian hieroglyph H008 that renders as .unicode-tricksThe Egyptian hieroglyph H007 that renders as .unicode-tricksThe Egyptian hieroglyph H006A that renders as .unicode-tricksThe Egyptian hieroglyph H006 that renders as .unicode-tricksThe Egyptian hieroglyph H005 that renders as .unicode-tricksThe Egyptian hieroglyph H004 that renders as .unicode-tricksThe Egyptian hieroglyph H003 that renders as .unicode-tricksThe Egyptian hieroglyph H002 that renders as .unicode-tricksThe Egyptian hieroglyph H001 that renders as .unicode-tricksThe Egyptian hieroglyph G054 that renders as .unicode-tricksThe Egyptian hieroglyph G053 that renders as .unicode-tricksThe Egyptian hieroglyph G052 that renders as .unicode-tricksThe Egyptian hieroglyph G051 that renders as .unicode-tricksThe Egyptian hieroglyph G050 that renders as .unicode-tricksThe Egyptian hieroglyph G049 that renders as .unicode-tricksThe Egyptian hieroglyph G048 that renders as .unicode-tricksThe Egyptian hieroglyph G047 that renders as .unicode-tricksThe Egyptian hieroglyph G046 that renders as .unicode-tricksThe Egyptian hieroglyph G045A that renders as .unicode-tricksThe Egyptian hieroglyph G045 that renders as .unicode-tricksThe Egyptian hieroglyph G044 that renders as .unicode-tricksThe Egyptian hieroglyph G043A that renders as .unicode-tricksThe Egyptian hieroglyph G043 that renders as .unicode-tricksThe Egyptian hieroglyph G042 that renders as .unicode-tricksThe Egyptian hieroglyph G041 that renders as .unicode-tricksThe Egyptian hieroglyph G040 that renders as .unicode-tricksThe Egyptian hieroglyph G039 that renders as .unicode-tricksThe Egyptian hieroglyph G038 that renders as .unicode-tricksThe Egyptian hieroglyph G037A that renders as .unicode-tricksThe Egyptian hieroglyph G037 that renders as .unicode-tricksThe Egyptian hieroglyph G036A that renders as .unicode-tricksThe Egyptian hieroglyph G036 that renders as .unicode-tricksThe Egyptian hieroglyph G035 that renders as .unicode-tricksThe Egyptian hieroglyph G034 that renders as .unicode-tricksThe Egyptian hieroglyph G033 that renders as .unicode-tricksThe Egyptian hieroglyph G032 that renders as .unicode-tricksThe Egyptian hieroglyph G031 that renders as .unicode-tricksThe Egyptian hieroglyph G030 that renders as .unicode-tricksThe Egyptian hieroglyph G029 that renders as .unicode-tricksThe Egyptian hieroglyph G028 that renders as .unicode-tricksThe Egyptian hieroglyph G027 that renders as .unicode-tricksThe Egyptian hieroglyph G026A that renders as .unicode-tricksThe Egyptian hieroglyph G026 that renders as .unicode-tricksThe Egyptian hieroglyph G025 that renders as .unicode-tricksThe Egyptian hieroglyph G024 that renders as .unicode-tricksThe Egyptian hieroglyph G023 that renders as .unicode-tricksThe Egyptian hieroglyph G022 that renders as .unicode-tricksThe Egyptian hieroglyph G021 that renders as .unicode-tricksThe Egyptian hieroglyph G020A that renders as .unicode-tricksThe Egyptian hieroglyph G020 that renders as .unicode-tricksThe Egyptian hieroglyph G019 that renders as .unicode-tricksThe Egyptian hieroglyph G018 that renders as .unicode-tricksThe Egyptian hieroglyph G017 that renders as .unicode-tricksThe Egyptian hieroglyph G016 that renders as .unicode-tricksThe Egyptian hieroglyph G015 that renders as .unicode-tricksThe Egyptian hieroglyph G014 that renders as .unicode-tricksThe Egyptian hieroglyph G013 that renders as .unicode-tricksThe Egyptian hieroglyph G012 that renders as .unicode-tricksThe Egyptian hieroglyph G011A that renders as .unicode-tricksThe Egyptian hieroglyph G011 that renders as .unicode-tricksThe Egyptian hieroglyph G010 that renders as .unicode-tricksThe Egyptian hieroglyph G009 that renders as .unicode-tricksThe Egyptian hieroglyph G008 that renders as .unicode-tricksThe Egyptian hieroglyph G007B that renders as .unicode-tricksThe Egyptian hieroglyph G007A that renders as .unicode-tricksThe Egyptian hieroglyph G007 that renders as .unicode-tricksThe Egyptian hieroglyph G006A that renders as .unicode-tricksThe Egyptian hieroglyph G006 that renders as .unicode-tricksThe Egyptian hieroglyph G005 that renders as .unicode-tricksThe Egyptian hieroglyph G004 that renders as .unicode-tricksThe Egyptian hieroglyph G003 that renders as .unicode-tricksThe Egyptian hieroglyph G002 that renders as .unicode-tricksThe Egyptian hieroglyph G001 that renders as .unicode-tricksThe Egyptian hieroglyph F053 that renders as .unicode-tricksThe Egyptian hieroglyph F052 that renders as .unicode-tricksThe Egyptian hieroglyph F051C that renders as .unicode-tricksThe Egyptian hieroglyph F051B that renders as .unicode-tricksThe Egyptian hieroglyph F051A that renders as .unicode-tricksThe Egyptian hieroglyph F051 that renders as .unicode-tricksThe Egyptian hieroglyph F050 that renders as .unicode-tricksThe Egyptian hieroglyph F049 that renders as .unicode-tricksThe Egyptian hieroglyph F048 that renders as .unicode-tricksThe Egyptian hieroglyph F047A that renders as .unicode-tricksThe Egyptian hieroglyph F047 that renders as .unicode-tricksThe Egyptian hieroglyph F046A that renders as .unicode-tricksThe Egyptian hieroglyph F046 that renders as .unicode-tricksThe Egyptian hieroglyph F045A that renders as .unicode-tricksThe Egyptian hieroglyph F045 that renders as .unicode-tricksThe Egyptian hieroglyph F044 that renders as .unicode-tricksThe Egyptian hieroglyph F043 that renders as .unicode-tricksThe Egyptian hieroglyph F042 that renders as .unicode-tricksThe Egyptian hieroglyph F041 that renders as .unicode-tricksThe Egyptian hieroglyph F040 that renders as .unicode-tricksThe Egyptian hieroglyph F039 that renders as .unicode-tricksThe Egyptian hieroglyph F038A that renders as .unicode-tricksThe Egyptian hieroglyph F038 that renders as .unicode-tricksThe Egyptian hieroglyph F037A that renders as .unicode-tricksThe Egyptian hieroglyph F037 that renders as .unicode-tricksThe Egyptian hieroglyph F036 that renders as .unicode-tricksThe Egyptian hieroglyph F035 that renders as .unicode-tricksThe Egyptian hieroglyph F034 that renders as .unicode-tricksThe Egyptian hieroglyph F033 that renders as .unicode-tricksThe Egyptian hieroglyph F032 that renders as .unicode-tricksThe Egyptian hieroglyph F031A that renders as .unicode-tricksThe Egyptian hieroglyph F031 that renders as .unicode-tricksThe Egyptian hieroglyph F030 that renders as .unicode-tricksThe Egyptian hieroglyph F029 that renders as .unicode-tricksThe Egyptian hieroglyph F028 that renders as .unicode-tricksThe Egyptian hieroglyph F027 that renders as .unicode-tricksThe Egyptian hieroglyph F026 that renders as .unicode-tricksThe Egyptian hieroglyph F025 that renders as .unicode-tricksThe Egyptian hieroglyph F024 that renders as .unicode-tricksThe Egyptian hieroglyph F023 that renders as .unicode-tricksThe Egyptian hieroglyph F022 that renders as .unicode-tricksThe Egyptian hieroglyph F021A that renders as .unicode-tricksThe Egyptian hieroglyph F021 that renders as .unicode-tricksThe Egyptian hieroglyph F020 that renders as .unicode-tricksThe Egyptian hieroglyph F019 that renders as .unicode-tricksThe Egyptian hieroglyph F018 that renders as .unicode-tricksThe Egyptian hieroglyph F017 that renders as .unicode-tricksThe Egyptian hieroglyph F016 that renders as .unicode-tricksThe Egyptian hieroglyph F015 that renders as .unicode-tricksThe Egyptian hieroglyph F014 that renders as .unicode-tricksThe Egyptian hieroglyph F013A that renders as .unicode-tricksThe Egyptian hieroglyph F013 that renders as .unicode-tricksThe Egyptian hieroglyph F012 that renders as .unicode-tricksThe Egyptian hieroglyph F011 that renders as .unicode-tricksThe Egyptian hieroglyph F010 that renders as .unicode-tricksThe Egyptian hieroglyph F009 that renders as .unicode-tricksThe Egyptian hieroglyph F008 that renders as .unicode-tricksThe Egyptian hieroglyph F007 that renders as .unicode-tricksThe Egyptian hieroglyph F006 that renders as .unicode-tricksThe Egyptian hieroglyph F005 that renders as .unicode-tricksThe Egyptian hieroglyph F004 that renders as .unicode-tricksThe Egyptian hieroglyph F003 that renders as .unicode-tricksThe Egyptian hieroglyph F002 that renders as .unicode-tricksThe Egyptian hieroglyph F001A that renders as .unicode-tricksThe Egyptian hieroglyph F001 that renders as .unicode-tricksThe Egyptian hieroglyph E038 that renders as .unicode-tricksThe Egyptian hieroglyph E037 that renders as .unicode-tricksThe Egyptian hieroglyph E036 that renders as .unicode-tricksThe Egyptian hieroglyph E034A that renders as .unicode-tricksThe Egyptian hieroglyph E034 that renders as .unicode-tricksThe Egyptian hieroglyph E033 that renders as .unicode-tricksThe Egyptian hieroglyph E032 that renders as .unicode-tricksThe Egyptian hieroglyph E031 that renders as .unicode-tricksThe Egyptian hieroglyph E030 that renders as .unicode-tricksThe Egyptian hieroglyph E029 that renders as .unicode-tricksThe Egyptian hieroglyph E028A that renders as .unicode-tricksThe Egyptian hieroglyph E028 that renders as .unicode-tricksThe Egyptian hieroglyph E027 that renders as .unicode-tricksThe Egyptian hieroglyph E026 that renders as .unicode-tricksThe Egyptian hieroglyph E025 that renders as .unicode-tricksThe Egyptian hieroglyph E024 that renders as .unicode-tricksThe Egyptian hieroglyph E023 that renders as .unicode-tricksThe Egyptian hieroglyph E022 that renders as .unicode-tricksThe Egyptian hieroglyph E021 that renders as .unicode-tricksThe Egyptian hieroglyph E020A that renders as .unicode-tricksThe Egyptian hieroglyph E020 that renders as .unicode-tricksThe Egyptian hieroglyph E019 that renders as .unicode-tricksThe Egyptian hieroglyph E018 that renders as .unicode-tricksThe Egyptian hieroglyph E017A that renders as .unicode-tricksThe Egyptian hieroglyph E017 that renders as .unicode-tricksThe Egyptian hieroglyph E016A that renders as .unicode-tricksThe Egyptian hieroglyph E016 that renders as .unicode-tricksThe Egyptian hieroglyph E015 that renders as .unicode-tricksThe Egyptian hieroglyph E014 that renders as .unicode-tricksThe Egyptian hieroglyph E013 that renders as .unicode-tricksThe Egyptian hieroglyph E012 that renders as .unicode-tricksThe Egyptian hieroglyph E011 that renders as .unicode-tricksThe Egyptian hieroglyph E010 that renders as .unicode-tricksThe Egyptian hieroglyph E009A that renders as .unicode-tricksThe Egyptian hieroglyph E009 that renders as .unicode-tricksThe Egyptian hieroglyph E008A that renders as .unicode-tricksThe Egyptian hieroglyph E008 that renders as .unicode-tricksThe Egyptian hieroglyph E007 that renders as .unicode-tricksThe Egyptian hieroglyph E006 that renders as .unicode-tricksThe Egyptian hieroglyph E005 that renders as .unicode-tricksThe Egyptian hieroglyph E004 that renders as .unicode-tricksThe Egyptian hieroglyph E003 that renders as .unicode-tricksThe Egyptian hieroglyph E002 that renders as .unicode-tricksThe Egyptian hieroglyph E001 that renders as .unicode-tricksThe Egyptian hieroglyph D067H that renders as .unicode-tricksThe Egyptian hieroglyph D067G that renders as .unicode-tricksThe Egyptian hieroglyph D067F that renders as .unicode-tricksThe Egyptian hieroglyph D067E that renders as .unicode-tricksThe Egyptian hieroglyph D067D that renders as .unicode-tricksThe Egyptian hieroglyph D067C that renders as .unicode-tricksThe Egyptian hieroglyph D067B that renders as .unicode-tricksThe Egyptian hieroglyph D067A that renders as .unicode-tricksThe Egyptian hieroglyph D067 that renders as .unicode-tricksThe Egyptian hieroglyph D066 that renders as .unicode-tricksThe Egyptian hieroglyph D065 that renders as .unicode-tricksThe Egyptian hieroglyph D064 that renders as .unicode-tricksThe Egyptian hieroglyph D063 that renders as .unicode-tricksThe Egyptian hieroglyph D062 that renders as .unicode-tricksThe Egyptian hieroglyph D061 that renders as .unicode-tricksThe Egyptian hieroglyph D060 that renders as .unicode-tricksThe Egyptian hieroglyph D059 that renders as .unicode-tricksThe Egyptian hieroglyph D058 that renders as .unicode-tricksThe Egyptian hieroglyph D057 that renders as .unicode-tricksThe Egyptian hieroglyph D056 that renders as .unicode-tricksThe Egyptian hieroglyph D055 that renders as .unicode-tricksThe Egyptian hieroglyph D054A that renders as .unicode-tricksThe Egyptian hieroglyph D054 that renders as .unicode-tricksThe Egyptian hieroglyph D053 that renders as .unicode-tricksThe Egyptian hieroglyph D052A that renders as .unicode-tricksThe Egyptian hieroglyph D052 that renders as .unicode-tricksThe Egyptian hieroglyph D051 that renders as .unicode-tricksThe Egyptian hieroglyph D050I that renders as .unicode-tricksThe Egyptian hieroglyph D050H that renders as .unicode-tricksThe Egyptian hieroglyph D050G that renders as .unicode-tricksThe Egyptian hieroglyph D050F that renders as .unicode-tricksThe Egyptian hieroglyph D050E that renders as .unicode-tricksThe Egyptian hieroglyph D050D that renders as .unicode-tricksThe Egyptian hieroglyph D050C that renders as .unicode-tricksThe Egyptian hieroglyph D050B that renders as .unicode-tricksThe Egyptian hieroglyph D050A that renders as .unicode-tricksThe Egyptian hieroglyph D050 that renders as .unicode-tricksThe Egyptian hieroglyph D049 that renders as .unicode-tricksThe Egyptian hieroglyph D048A that renders as .unicode-tricksThe Egyptian hieroglyph D048 that renders as .unicode-tricksThe Egyptian hieroglyph D047 that renders as .unicode-tricksThe Egyptian hieroglyph D046A that renders as .unicode-tricksThe Egyptian hieroglyph D046 that renders as .unicode-tricksThe Egyptian hieroglyph D045 that renders as .unicode-tricksThe Egyptian hieroglyph D044 that renders as .unicode-tricksThe Egyptian hieroglyph D043 that renders as .unicode-tricksThe Egyptian hieroglyph D042 that renders as .unicode-tricksThe Egyptian hieroglyph D041 that renders as .unicode-tricksThe Egyptian hieroglyph D040 that renders as .unicode-tricksThe Egyptian hieroglyph D039 that renders as .unicode-tricksThe Egyptian hieroglyph D038 that renders as .unicode-tricksThe Egyptian hieroglyph D037 that renders as .unicode-tricksThe Egyptian hieroglyph D036 that renders as .unicode-tricksThe Egyptian hieroglyph D035 that renders as .unicode-tricksThe Egyptian hieroglyph D034A that renders as .unicode-tricksThe Egyptian hieroglyph D034 that renders as .unicode-tricksThe Egyptian hieroglyph D033 that renders as .unicode-tricksThe Egyptian hieroglyph D032 that renders as .unicode-tricksThe Egyptian hieroglyph D031A that renders as .unicode-tricksThe Egyptian hieroglyph D031 that renders as .unicode-tricksThe Egyptian hieroglyph D030 that renders as .unicode-tricksThe Egyptian hieroglyph D029 that renders as .unicode-tricksThe Egyptian hieroglyph D028 that renders as .unicode-tricksThe Egyptian hieroglyph D027A that renders as .unicode-tricksThe Egyptian hieroglyph D027 that renders as .unicode-tricksThe Egyptian hieroglyph D026 that renders as .unicode-tricksThe Egyptian hieroglyph D025 that renders as .unicode-tricksThe Egyptian hieroglyph D024 that renders as .unicode-tricksThe Egyptian hieroglyph D023 that renders as .unicode-tricksThe Egyptian hieroglyph D022 that renders as .unicode-tricksThe Egyptian hieroglyph D021 that renders as .unicode-tricksThe Egyptian hieroglyph D020 that renders as .unicode-tricksThe Egyptian hieroglyph D019 that renders as .unicode-tricksThe Egyptian hieroglyph D018 that renders as .unicode-tricksThe Egyptian hieroglyph D017 that renders as .unicode-tricksThe Egyptian hieroglyph D016 that renders as .unicode-tricksThe Egyptian hieroglyph D015 that renders as .unicode-tricksThe Egyptian hieroglyph D014 that renders as .unicode-tricksThe Egyptian hieroglyph D013 that renders as .unicode-tricksThe Egyptian hieroglyph D012 that renders as .unicode-tricksThe Egyptian hieroglyph D011 that renders as .unicode-tricksThe Egyptian hieroglyph D010 that renders as .unicode-tricksThe Egyptian hieroglyph D009 that renders as .unicode-tricksThe Egyptian hieroglyph D008A that renders as .unicode-tricksThe Egyptian hieroglyph D008 that renders as .unicode-tricksThe Egyptian hieroglyph D007 that renders as .unicode-tricksThe Egyptian hieroglyph D006 that renders as .unicode-tricksThe Egyptian hieroglyph D005 that renders as .unicode-tricksThe Egyptian hieroglyph D004 that renders as .unicode-tricksThe Egyptian hieroglyph D003 that renders as .unicode-tricksThe Egyptian hieroglyph D002 that renders as .unicode-tricksThe Egyptian hieroglyph D001 that renders as .unicode-tricksThe Egyptian hieroglyph C024 that renders as .unicode-tricksThe Egyptian hieroglyph C023 that renders as .unicode-tricksThe Egyptian hieroglyph C022 that renders as .unicode-tricksThe Egyptian hieroglyph C021 that renders as .unicode-tricksThe Egyptian hieroglyph C020 that renders as .unicode-tricksThe Egyptian hieroglyph C019 that renders as .unicode-tricksThe Egyptian hieroglyph C018 that renders as .unicode-tricksThe Egyptian hieroglyph C017 that renders as .unicode-tricksThe Egyptian hieroglyph C016 that renders as .unicode-tricksThe Egyptian hieroglyph C015 that renders as .unicode-tricksThe Egyptian hieroglyph C014 that renders as .unicode-tricksThe Egyptian hieroglyph C013 that renders as .unicode-tricksThe Egyptian hieroglyph C012 that renders as .unicode-tricksThe Egyptian hieroglyph C011 that renders as .unicode-tricksThe Egyptian hieroglyph C010A that renders as .unicode-tricksThe Egyptian hieroglyph C010 that renders as .unicode-tricksThe Egyptian hieroglyph C009 that renders as .unicode-tricksThe Egyptian hieroglyph C008 that renders as .unicode-tricksThe Egyptian hieroglyph C007 that renders as .unicode-tricksThe Egyptian hieroglyph C006 that renders as .unicode-tricksThe Egyptian hieroglyph C005 that renders as .unicode-tricksThe Egyptian hieroglyph C004 that renders as .unicode-tricksThe Egyptian hieroglyph C003 that renders as .unicode-tricksThe Egyptian hieroglyph C002C that renders as .unicode-tricksThe Egyptian hieroglyph C002B that renders as .unicode-tricksThe Egyptian hieroglyph C002A that renders as .unicode-tricksThe Egyptian hieroglyph C002 that renders as .unicode-tricksThe Egyptian hieroglyph C001 that renders as .unicode-tricksThe Egyptian hieroglyph B009 that renders as .unicode-tricksThe Egyptian hieroglyph B008 that renders as .unicode-tricksThe Egyptian hieroglyph B007 that renders as .unicode-tricksThe Egyptian hieroglyph B006 that renders as .unicode-tricksThe Egyptian hieroglyph B005A that renders as .unicode-tricksThe Egyptian hieroglyph B005 that renders as .unicode-tricksThe Egyptian hieroglyph B004 that renders as .unicode-tricksThe Egyptian hieroglyph B003 that renders as .unicode-tricksThe Egyptian hieroglyph B002 that renders as .unicode-tricksThe Egyptian hieroglyph B001 that renders as .unicode-tricksThe Egyptian hieroglyph A070 that renders as .unicode-tricksThe Egyptian hieroglyph A069 that renders as .unicode-tricksThe Egyptian hieroglyph A068 that renders as .unicode-tricksThe Egyptian hieroglyph A067 that renders as .unicode-tricksThe Egyptian hieroglyph A066 that renders as .unicode-tricksThe Egyptian hieroglyph A065 that renders as .unicode-tricksThe Egyptian hieroglyph A064 that renders as .unicode-tricksThe Egyptian hieroglyph A063 that renders as .unicode-tricksThe Egyptian hieroglyph A062 that renders as .unicode-tricksThe Egyptian hieroglyph A061 that renders as .unicode-tricksThe Egyptian hieroglyph A060 that renders as .unicode-tricksThe Egyptian hieroglyph A059 that renders as .unicode-tricksThe Egyptian hieroglyph A058 that renders as .unicode-tricksThe Egyptian hieroglyph A057 that renders as .unicode-tricksThe Egyptian hieroglyph A056 that renders as .unicode-tricksThe Egyptian hieroglyph A055 that renders as .unicode-tricksThe Egyptian hieroglyph A054 that renders as .unicode-tricksThe Egyptian hieroglyph A053 that renders as .unicode-tricksThe Egyptian hieroglyph A052 that renders as .unicode-tricksThe Egyptian hieroglyph A051 that renders as .unicode-tricksThe Egyptian hieroglyph A050 that renders as .unicode-tricksThe Egyptian hieroglyph A049 that renders as .unicode-tricksThe Egyptian hieroglyph A048 that renders as .unicode-tricksThe Egyptian hieroglyph A047 that renders as .unicode-tricksThe Egyptian hieroglyph A046 that renders as .unicode-tricksThe Egyptian hieroglyph A045A that renders as .unicode-tricksThe Egyptian hieroglyph A045 that renders as .unicode-tricksThe Egyptian hieroglyph A044 that renders as .unicode-tricksThe Egyptian hieroglyph A043A that renders as .unicode-tricksThe Egyptian hieroglyph A043 that renders as .unicode-tricksThe Egyptian hieroglyph A042A that renders as .unicode-tricksThe Egyptian hieroglyph A042 that renders as .unicode-tricksThe Egyptian hieroglyph A041 that renders as .unicode-tricksThe Egyptian hieroglyph A040A that renders as .unicode-tricksThe Egyptian hieroglyph A040 that renders as .unicode-tricksThe Egyptian hieroglyph A039 that renders as .unicode-tricksThe Egyptian hieroglyph A038 that renders as .unicode-tricksThe Egyptian hieroglyph A037 that renders as .unicode-tricksThe Egyptian hieroglyph A036 that renders as .unicode-tricksThe Egyptian hieroglyph A035 that renders as .unicode-tricksThe Egyptian hieroglyph A034 that renders as .unicode-tricksThe Egyptian hieroglyph A033 that renders as .unicode-tricksThe Egyptian hieroglyph A032A that renders as .unicode-tricksThe Egyptian hieroglyph A032 that renders as .unicode-tricksThe Egyptian hieroglyph A031 that renders as .unicode-tricksThe Egyptian hieroglyph A030 that renders as .unicode-tricksThe Egyptian hieroglyph A029 that renders as .unicode-tricksThe Egyptian hieroglyph A028 that renders as .unicode-tricksThe Egyptian hieroglyph A027 that renders as .unicode-tricksThe Egyptian hieroglyph A026 that renders as .unicode-tricksThe Egyptian hieroglyph A025 that renders as .unicode-tricksThe Egyptian hieroglyph A024 that renders as .unicode-tricksThe Egyptian hieroglyph A023 that renders as .unicode-tricksThe Egyptian hieroglyph A022 that renders as .unicode-tricksThe Egyptian hieroglyph A021 that renders as .unicode-tricksThe Egyptian hieroglyph A020 that renders as .unicode-tricksThe Egyptian hieroglyph A019 that renders as .unicode-tricksThe Egyptian hieroglyph A018 that renders as .unicode-tricksThe Egyptian hieroglyph A017A that renders as .unicode-tricksThe Egyptian hieroglyph A017 that renders as .unicode-tricksThe Egyptian hieroglyph A016 that renders as .unicode-tricksThe Egyptian hieroglyph A015 that renders as .unicode-tricksThe Egyptian hieroglyph A014A that renders as .unicode-tricksThe Egyptian hieroglyph A014 that renders as .unicode-tricksThe Egyptian hieroglyph A013 that renders as .unicode-tricksThe Egyptian hieroglyph A012 that renders as .unicode-tricksThe Egyptian hieroglyph A011 that renders as .unicode-tricksThe Egyptian hieroglyph A010 that renders as .unicode-tricksThe Egyptian hieroglyph A009 that renders as .unicode-tricksThe Egyptian hieroglyph A008 that renders as .unicode-tricksThe Egyptian hieroglyph A007 that renders as .unicode-tricksThe Egyptian hieroglyph A006B that renders as .unicode-tricksThe Egyptian hieroglyph A006A that renders as .unicode-tricksThe Egyptian hieroglyph A006 that renders as .unicode-tricksThe Egyptian hieroglyph A005A that renders as .unicode-tricksThe Egyptian hieroglyph A005 that renders as .unicode-tricksThe Egyptian hieroglyph A004 that renders as .unicode-tricksThe Egyptian hieroglyph A003 that renders as .unicode-tricksThe Egyptian hieroglyph A002 that renders as .unicode-tricksThe Egyptian hieroglyph A001 that renders as . A module to map alphanumerical characters to their equivalent in an enclosed forms.hapytexeu+gh@gmail.com experimentalPOSIXSafe^unicode-tricksConvert the given number to a 0acter where the number is circled wrapped in a  . This works for numbers in the 0-20( range. For numbers outside this range  is returned.unicode-tricksConvert the given number to a acter where the number is circled. This works for numbers in the 0-20 range. For numbers outside this range, the behavior is unspecified.unicode-tricks+Convert the given upper case or lower case acter to a character that is circled. The result is wrapped in a 0 data constructor. If the value is outside the A-Z,a-z range,  is returned.unicode-tricks+Convert the given upper case or lower case acter to a character that is circled. If the value is outside the A-Z,a-z# range, the result is unspecified.unicode-tricksConvert the given number to a 6acter where the number is parenthesized wrapped in a 1 data constructor. If the number is outside the 1-20 range,  is returned.unicode-tricksConvert the given number to a acter where the number is parenthesized. If the number is outside the 1-20# range, the result is unspecified.unicode-tricksConvert the given number to a 2acter where the number is succeeded by a period (.) wrapped in a 1 data constructor. If the number is outside the 0-20 range,  is returned.unicode-tricksConvert the given number to 2acter where the number is succeeded by a period (. ). If the number is outside the 0-20# range, the result is unspecified.unicode-tricksConvert the given number to a acter where the number is double circled. The result is wrapped in a 7 data constructor. If the given number is outside the 1-10 range,  is returned.unicode-tricksConvert the given number to a acter where the number is double circled. If the given number is outside the 1-10# range, the result is unspecified.unicode-tricksConvert the given number to a 1acter where the number is succeeded by a comma (,). The result is wrapped in a 7 data constructor. If the given number is outside the 0-9 range,  is returned.unicode-tricksConvert the given number to a 1acter where the number is succeeded by a comma (,&). If the given number is outside the 0-9# range, the result is unspecified.unicode-tricks+Convert the given upper case or lower case  acter to a =acter where it is parenthesized. The result is wrapped in a 0 data constructor. If the value is outside the A-Z,a-z range,  is returned.unicode-tricks:Convert the given upper case or lower case character to a >acter where it is parenthesized. If the value is outside the A-Z,a-z# range, the result is unspecified.unicode-tricks,Convert the given upper case character to a acter where it is squared (put in a square box). The result is wrapped in a 0 data constructor. If the value is outside the A-Z range,  is returned.unicode-tricks,Convert the given upper case character to a acter where it is squared (put in a square box). If the value is outside the A-Z# range, the result is unspecified.unicode-tricksConvert the given upper case character to a character where the character is written in white on a black circle. The result is wrapped in a 6 data constructor. If the given value is outside the A-Z range,  is returned.unicode-tricksConvert the given upper case character to a character where the character is written in white on a black circle. If the given value is outside the A-Z" range, the result is unspecified.unicode-tricksConvert the given upper case character to a character where the character is written in white on a black square. The result is wrapped in a 6 data constructor. If the given value is outside the A-Z range,  is returned.unicode-tricksConvert the given upper case character to a character where the character is written in white on a black square. If the given value is outside the A-Z" range, the result is unspecified.unicode-tricksConvert the given number to a character where the number is written in white on a black circle. The result is wrapped in a 6 data constructor. If the given value is outside the 0,11-20 range,  is returned.unicode-tricksConvert the given number to a character where the number is written in white on a black circle. If the given value is outside the 0,11-20# range, the result is unspecified.unicode-tricksConvert the given upper case character to a regional indicator character. The result is wrapped in a 0 data constructor. If the value is outside the A-Z range,  is returned. The regional indicators are used for flag emojis. Two consecutive regional indicators that together form an ISO 63166 Alpha-2 code, then this will result in the corresponding flag Emoji. Deprecated countries like the Soviet Union (SU) and Yugoslavia (YU) do not have a flag emoji. Antarctica (AQ), the European Union (EU) and the United Nations (UN) have a flag emoji.unicode-tricksConvert the given upper case character to a regional indicator character. If the value is outside the A-Z" range, the result is unspecified.The regional indicators are used for flag emojis. Two consecutive regional indicators that together form an ISO 63166 Alpha-2 code, then this will result in the corresponding flag Emoji. Deprecated countries like the Soviet Union (SU) and Yugoslavia (YU) do not have a flag emoji. Antarctica (AQ), the European Union (EU) and the United Nations (UN) have a flag emoji.unicode-tricksThe given number to convert.unicode-tricksA ?acter that is circled variant of the given number wrapped in a  data constructor if it exists;  otherwise.unicode-tricksThe given number to convert.unicode-tricks field that contains the given hours between 0 and 12, and a  field that if /, means that the clock is half past that hour.unicode-tricksThe number of hours on the given clock. Is between 0 and 12. For 0, the  is ; and for 12, the  is .unicode-tricksIs * if it is half past the given hour on the .unicode-tricksA data type to store a subregion flag. This is specified by the parent flag, and three characters of the subregion. At the moment, the only three subregional flags are England (eng), Scotland (sct) and Wales (wls), all beloning under the United Kingdom flag (GB). The data constructor is made private to prevent making non-existing subflags.unicode-tricksA data type that stores a (country) flag by the two characters of the ISO 3166 Alpa-2 standard. The data constructor is hidden to prevent making flags with a combination of characters that is invalid. Besides the countries defined in the ISO-3166 Alpha-2 standard, only the Antarctica (AQ), the European Union (EU) and the United Nations (UN) have a flag. Deprecated territories like the Soviet Union (SU) and Yugoslavia (YU) have no corresponding flag.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksAn English name for the  zodiac sign.unicode-tricksAn English name for the  zodiac sign.unicode-tricksAn English name for the  zodiac sign.unicode-tricks%The name of the constellation of the  zodiac sign.unicode-tricksAn English name for the  zodiac sign.unicode-tricksAn English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricks%The name of the constellation of the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe English name for the  zodiac sign.unicode-tricksThe : that corresponds to type six of the /Fitzpatrick scale/.unicode-tricksThe ; that corresponds to type five of the /Fitzpatrick scale/.unicode-tricksThe ; that corresponds to type four of the /Fitzpatrick scale/.unicode-tricksThe < that corresponds to type three of the /Fitzpatrick scale/.unicode-tricksThe : that corresponds to type two of the /Fitzpatrick scale/.unicode-tricksThe : that corresponds to type one of the /Fitzpatrick scale/.unicode-tricksThe  pattern use for Wales denoted with GB-WLS or WLS.unicode-tricksThe  pattern use for Scotland denoted with GB-SCT or SCT.unicode-tricksThe  pattern use for England denoted with GB-ENG or ENG.unicode-tricksThe  pattern used for Zimbabwe denoted with ZW.unicode-tricksThe  pattern used for Zambia denoted with ZM.unicode-tricksThe  pattern used for  South Africa denoted with ZA.unicode-tricksThe  pattern used for Mayotte denoted with YT.unicode-tricksThe  pattern used for Yemen denoted with YE.unicode-tricksThe  pattern used for Kosovo denoted with XK.unicode-tricksThe  pattern used for Samoa denoted with WS.unicode-tricksThe  pattern used for Wallis & Futuna denoted with WF.unicode-tricksThe  pattern used for Vanuatu denoted with VU.unicode-tricksThe  pattern used for Vietnam denoted with VN.unicode-tricksThe  pattern used for the U.S. Virgin Islands denoted with VI.unicode-tricksThe  pattern used for the British Virgin Islands denoted with VG.unicode-tricksThe  pattern used for  Venezuela denoted with VE.unicode-tricksThe  pattern used for St. Vincent & Grenadines denoted with VC.unicode-tricksThe  pattern used for  Vatican City denoted with VA.unicode-tricksThe  pattern used for  Uzbekistan denoted with UZ.unicode-tricksThe  pattern used for Uruguay denoted with UY.unicode-tricksThe  pattern used for the  United States denoted with US.unicode-tricksThe  pattern used for the United Nations denoted with UN.unicode-tricksThe  pattern used for the U.S. Outlying Islands denoted with UM.unicode-tricksThe  pattern used for Uganda denoted with UG.unicode-tricksThe  pattern used for Ukraine denoted with UA.unicode-tricksThe  pattern used for Tanzania denoted with TZ.unicode-tricksThe  pattern used for Taiwan denoted with TW.unicode-tricksThe  pattern used for Tuvalu denoted with TV.unicode-tricksThe  pattern used for Trinidad & Tobago denoted with TT.unicode-tricksThe  pattern used for Turkey denoted with TR.unicode-tricksThe  pattern used for Tonga denoted with TO.unicode-tricksThe  pattern used for Tunisia denoted with TN.unicode-tricksThe  pattern used for  Turkmenistan denoted with TM.unicode-tricksThe  pattern used for  Timor-Leste denoted with TL.unicode-tricksThe  pattern used for Tokelau denoted with TK.unicode-tricksThe  pattern used for  Tajikistan denoted with TJ.unicode-tricksThe  pattern used for Thailand denoted with TH.unicode-tricksThe  pattern used for Togo denoted with TG.unicode-tricksThe  pattern used for the French Southern Territories denoted with TF.unicode-tricksThe  pattern used for Chad denoted with TD.unicode-tricksThe  pattern used for the Turks & Caicos Islands denoted with TC.unicode-tricksThe  pattern used for Tristan da Cunha denoted with TA.unicode-tricksThe  pattern used for Eswatini denoted with SZ.unicode-tricksThe  pattern used for Syria denoted with SY.unicode-tricksThe  pattern used for  Sint Maarten denoted with SX.unicode-tricksThe  pattern used for  El Salvador denoted with SV.unicode-tricksThe  pattern used for So Tom & Prncipe denoted with ST.unicode-tricksThe  pattern used for  South Sudan denoted with SS.unicode-tricksThe  pattern used for Suriname denoted with SR.unicode-tricksThe  pattern used for Somalia denoted with SO.unicode-tricksThe  pattern used for Senegal denoted with SN.unicode-tricksThe  pattern used for  San Marino denoted with SM.unicode-tricksThe  pattern used for  Sierra Leone denoted with SL.unicode-tricksThe  pattern used for Slovakia denoted with SK.unicode-tricksThe  pattern used for Svalbard & Jan Mayen denoted with SJ.unicode-tricksThe  pattern used for Slovenia denoted with SI.unicode-tricksThe  pattern used for  St. Helena denoted with SH.unicode-tricksThe  pattern used for  Singapore denoted with SG.unicode-tricksThe  pattern used for Sweden denoted with SE.unicode-tricksThe  pattern used for Sudan denoted with SD.unicode-tricksThe  pattern used for  Seychelles denoted with SC.unicode-tricksThe  pattern used for the Solomon Islands denoted with SB.unicode-tricksThe  pattern used for  Saudi Arabia denoted with SA.unicode-tricksThe  pattern used for Rwanda denoted with RW.unicode-tricksThe  pattern used for Russia denoted with RU.unicode-tricksThe  pattern used for Serbia denoted with RS.unicode-tricksThe  pattern used for Romania denoted with RO.unicode-tricksThe  pattern used for Runion denoted with RE.unicode-tricksThe  pattern used for Qatar denoted with QA.unicode-tricksThe  pattern used for Paraguay denoted with PY.unicode-tricksThe  pattern used for Palau denoted with PW.unicode-tricksThe  pattern used for Portugal denoted with PT.unicode-tricksThe  pattern used for the Palestinian Territories denoted with PS.unicode-tricksThe  pattern used for  Puerto Rico denoted with PR.unicode-tricksThe  pattern used for the Pitcairn Islands denoted with PN.unicode-tricksThe  pattern used for St. Pierre & Miquelon denoted with PM.unicode-tricksThe  pattern used for Poland denoted with PL.unicode-tricksThe  pattern used for Pakistan denoted with PK.unicode-tricksThe  pattern used for the  Philippines denoted with PH.unicode-tricksThe  pattern used for Papua New Guinea denoted with PG.unicode-tricksThe  pattern used for French Polynesia denoted with PF.unicode-tricksThe  pattern used for Peru denoted with PE.unicode-tricksThe  pattern used for Panama denoted with PA.unicode-tricksThe  pattern used for Oman denoted with OM.unicode-tricksThe  pattern used for  New Zealand denoted with NZ.unicode-tricksThe  pattern used for Niue denoted with NU.unicode-tricksThe  pattern used for Nauru denoted with NR.unicode-tricksThe  pattern used for Nepal denoted with NP.unicode-tricksThe  pattern used for Norway denoted with NO.unicode-tricksThe  pattern used for the  Netherlands denoted with NL.unicode-tricksThe  pattern used for  Nicaragua denoted with NI.unicode-tricksThe  pattern used for Nigeria denoted with NG.unicode-tricksThe  pattern used for Norfolk Island denoted with NF.unicode-tricksThe  pattern used for Niger denoted with NE.unicode-tricksThe  pattern used for  New Caledonia denoted with NC.unicode-tricksThe  pattern used for Namibia denoted with NA.unicode-tricksThe  pattern used for  Mozambique denoted with MZ.unicode-tricksThe  pattern used for Malaysia denoted with MY.unicode-tricksThe  pattern used for Mexico denoted with MX.unicode-tricksThe  pattern used for Malawi denoted with MW.unicode-tricksThe  pattern used for the Maldives denoted with MV.unicode-tricksThe  pattern used for  Mauritius denoted with MU.unicode-tricksThe  pattern used for Malta denoted with MT.unicode-tricksThe  pattern used for  Montserrat denoted with MS.unicode-tricksThe  pattern used for  Mauritania denoted with MR.unicode-tricksThe  pattern used for  Martinique denoted with MQ.unicode-tricksThe  pattern used for the Northern Mariana Islands denoted with MP.unicode-tricksThe  pattern used for Macao SAR China denoted with MO.unicode-tricksThe  pattern used for Mongolia denoted with MN.unicode-tricksThe  pattern used for Myanmar (Burma) denoted with MM.unicode-tricksThe  pattern used for Mali denoted with ML.unicode-tricksThe  pattern used for North Macedonia denoted with MK.unicode-tricksThe  pattern used for the Marshall Islands denoted with MH.unicode-tricksThe  pattern used for  Madagascar denoted with MG.unicode-tricksThe  pattern used for  St. Martin denoted with MF.unicode-tricksThe  pattern used for  Montenegro denoted with ME.unicode-tricksThe  pattern used for Moldova denoted with MD.unicode-tricksThe  pattern used for Monaco denoted with MC.unicode-tricksThe  pattern used for Morocco denoted with MA.unicode-tricksThe  pattern used for Libya denoted with LY.unicode-tricksThe  pattern used for Latvia denoted with LV.unicode-tricksThe  pattern used for  Luxembourg denoted with LU.unicode-tricksThe  pattern used for  Lithuania denoted with LT.unicode-tricksThe  pattern used for Lesotho denoted with LS.unicode-tricksThe  pattern used for Liberia denoted with LR.unicode-tricksThe  pattern used for  Sri Lanka denoted with LK.unicode-tricksThe  pattern used for  Liechtenstein denoted with LI.unicode-tricksThe  pattern used for  St. Lucia denoted with LC.unicode-tricksThe  pattern used for Lebanon denoted with LB.unicode-tricksThe  pattern used for Laos denoted with LA.unicode-tricksThe  pattern used for  Kazakhstan denoted with KZ.unicode-tricksThe  pattern used for the Cayman Islands denoted with KY.unicode-tricksThe  pattern used for Kuwait denoted with KW.unicode-tricksThe  pattern used for  South Korea denoted with KR.unicode-tricksThe  pattern used for  North Korea denoted with KP.unicode-tricksThe  pattern used for St. Kitts & Nevis denoted with KN.unicode-tricksThe  pattern used for the Comoros denoted with KM.unicode-tricksThe  pattern used for Kiribati denoted with KI.unicode-tricksThe  pattern used for Cambodia denoted with KH.unicode-tricksThe  pattern used for  Kyrgyzstan denoted with KG.unicode-tricksThe  pattern used for Kenya denoted with KE.unicode-tricksThe  pattern used for Japan denoted with JP.unicode-tricksThe  pattern used for Jordan denoted with JO.unicode-tricksThe  pattern used for Jamaica denoted with JM.unicode-tricksThe  pattern used for Jersey denoted with JE.unicode-tricksThe  pattern used for Italy denoted with IT.unicode-tricksThe  pattern used for Iceland denoted with IS.unicode-tricksThe  pattern used for Iran denoted with IR.unicode-tricksThe  pattern used for Iraq denoted with IQ.unicode-tricksThe  pattern used for British Indian Ocean Territory denoted with IO.unicode-tricksThe  pattern used for India denoted with IN.unicode-tricksThe  pattern used for  Isle of Man denoted with IM.unicode-tricksThe  pattern used for Israel denoted with IL.unicode-tricksThe  pattern used for Ireland denoted with IE.unicode-tricksThe  pattern used for  Indonesia denoted with ID.unicode-tricksThe  pattern used for the Canary Islands denoted with IC.unicode-tricksThe  pattern used for Hungary denoted with HU.unicode-tricksThe  pattern used for Haiti denoted with HT.unicode-tricksThe  pattern used for Croatia denoted with HR.unicode-tricksThe  pattern used for Honduras denoted with HN.unicode-tricksThe  pattern used for the Heard & McDonald Islands denoted with HM.unicode-tricksThe  pattern used for Hong Kong SAR China denoted with HK.unicode-tricksThe  pattern used for Guyana denoted with GY.unicode-tricksThe  pattern used for  Guinea-Bissau denoted with GW.unicode-tricksThe  pattern used for Guam denoted with GU.unicode-tricksThe  pattern used for  Guatemala denoted with GT.unicode-tricksThe  pattern used for the &South Georgia & South Sandwich Islands denoted with GS.unicode-tricksThe  pattern used for Greece denoted with GR.unicode-tricksThe  pattern used for Equatorial Guinea denoted with GQ.unicode-tricksThe  pattern used for  Guadeloupe denoted with GP.unicode-tricksThe  pattern used for Guinea denoted with GN.unicode-tricksThe  pattern used for Gambia denoted with GM.unicode-tricksThe  pattern used for  Greenland denoted with GL.unicode-tricksThe  pattern used for  Gibraltar denoted with GI.unicode-tricksThe  pattern used for Ghana denoted with GH.unicode-tricksThe  pattern used for Guernsey denoted with GG.unicode-tricksThe  pattern used for  French Guiana denoted with GF.unicode-tricksThe  pattern used for Georgia denoted with GE.unicode-tricksThe  pattern used for Grenada denoted with GD.unicode-tricksThe  pattern used for United Kingdom denoted with GB.unicode-tricksThe  pattern used for Gabon denoted with GA.unicode-tricksThe  pattern used for France denoted with FR.unicode-tricksThe  pattern used for the  Faroe Islands denoted with FO.unicode-tricksThe  pattern used for  Micronesia denoted with FM.unicode-tricksThe  pattern used for the Falkland Islands denoted with FK.unicode-tricksThe  pattern used for Fiji denoted with FJ.unicode-tricksThe  pattern used for Finland denoted with FI.unicode-tricksThe  pattern used for the European Union denoted with EU.unicode-tricksThe  pattern used for Ethiopia denoted with ET.unicode-tricksThe  pattern used for Spain denoted with ES.unicode-tricksThe  pattern used for Eritrea denoted with ER.unicode-tricksThe  pattern used for Western Sahara denoted with EH.unicode-tricksThe  pattern used for Egypt denoted with EG.unicode-tricksThe  pattern used for Estonia denoted with EE.unicode-tricksThe  pattern used for Ecuador denoted with EC.unicode-tricksThe  pattern used for Ceuta & Melilla denoted with EA.unicode-tricksThe  pattern used for Algeria denoted with DZ.unicode-tricksThe  pattern used for Dominican Republic denoted with DO.unicode-tricksThe  pattern used for Dominica denoted with DM.unicode-tricksThe  pattern used for Denmark denoted with DK.unicode-tricksThe  pattern used for Djibouti denoted with DJ.unicode-tricksThe  pattern used for  Diego Garcia denoted with DG.unicode-tricksThe  pattern used for Germany denoted with DE.unicode-tricksThe  pattern used for Czechia denoted with CZ.unicode-tricksThe  pattern used for Cyprus denoted with CY.unicode-tricksThe  pattern used for Christmas Island denoted with CX.unicode-tricksThe  pattern used for Curaao denoted with CW.unicode-tricksThe  pattern used for  Cape Verde denoted with CV.unicode-tricksThe  pattern used for Cuba denoted with CU.unicode-tricksThe  pattern used for  Costa Rica denoted with CR.unicode-tricksThe  pattern used for Clipperton Island denoted with CP.unicode-tricksThe  pattern used for Colombia denoted with CO.unicode-tricksThe  pattern used for China denoted with CN.unicode-tricksThe  pattern used for Cameroon denoted with CM.unicode-tricksThe  pattern used for Chile denoted with CL.unicode-tricksThe  pattern used for the  Cook Islands denoted with CK.unicode-tricksThe  pattern used for  Cte d@Ivoire denoted with CI.unicode-tricksThe  pattern used for  Switzerland denoted with CH.unicode-tricksThe  pattern used for Congo - Brazzaville denoted with CG.unicode-tricksThe  pattern used for Central African Republic denoted with CF.unicode-tricksThe  pattern used for Congo - Kinshasa denoted with CD.unicode-tricksThe  pattern used for the Cocos (Keeling) Islands denoted with CC.unicode-tricksThe  pattern used for Canada denoted with CA.unicode-tricksThe  pattern used for Belize denoted with BZ.unicode-tricksThe  pattern used for Belarus denoted with BY.unicode-tricksThe  pattern used for Botswana denoted with BW.unicode-tricksThe  pattern used for  Bouvet Island denoted with BV.unicode-tricksThe  pattern used for Bhutan denoted with BT.unicode-tricksThe  pattern used for the Bahamas denoted with BS.unicode-tricksThe  pattern used for Brazil denoted with BR.unicode-tricksThe  pattern used for the Caribbean Netherlands denoted with BQ.unicode-tricksThe  pattern used for Bolivia denoted with BO.unicode-tricksThe  pattern used for Brunei denoted with BN.unicode-tricksThe  pattern used for Bermuda denoted with BM.unicode-tricksThe  pattern used for St. Barthlemy denoted with BL.unicode-tricksThe  pattern used for Benin denoted with BJ.unicode-tricksThe  pattern used for Burundi denoted with BI.unicode-tricksThe  pattern used for Bahrain denoted with BH.unicode-tricksThe  pattern used for Bulgaria denoted with BG.unicode-tricksThe  pattern used for  Burkina Faso denoted with BF.unicode-tricksThe  pattern used for Belgium denoted with BE.unicode-tricksThe  pattern used for  Bangladesh denoted with BD.unicode-tricksThe  pattern used for Barbados denoted with BB.unicode-tricksThe  pattern used for Bosnia & Herzegovina denoted with BA.unicode-tricksThe  pattern used for  Azerbaijan denoted with AZ.unicode-tricksThe  pattern used for the  land Islands denoted with AX.unicode-tricksThe  pattern used for Aruba denoted with AW.unicode-tricksThe  pattern used for  Australia denoted with AU.unicode-tricksThe  pattern used for Austria denoted with AT.unicode-tricksThe  pattern used for American Samoa denoted with AS.unicode-tricksThe  pattern used for  Argentina denoted with AR.unicode-tricksThe  pattern used for  Antarctica denoted with AQ.unicode-tricksThe  pattern used for Angola denoted with AO.unicode-tricksThe  pattern used for Armenia denoted with AM.unicode-tricksThe  pattern used for Albania denoted with AL.unicode-tricksThe  pattern used for Anguilla denoted with AI.unicode-tricksThe  pattern used for Antigua & Barbuda denoted with AG.unicode-tricksThe  pattern used for  Afghanistan denoted with AF.unicode-tricksThe  pattern used for the United Arab Emirates denoted with AE.unicode-tricksThe  pattern used for Andorra denoted with AD.unicode-tricksThe  pattern used for Ascension Island denoted with AC.unicode-tricksA acter that is often used as a suffix to turn a character into an emoji.unicode-tricksConvert the given two characters that represent a flag according to the ISO 3166 Alpha-2 standard to a  wrapped in a ) data constructor, if that flag exists; 4 otherwise. One can pass characters in upper case (A-Z) and lower case (a-z). The flag will hold the upper case variant. The Emoji have flags for the countries defined by the ISO 3166 Alpha-2 standard without deprecated regions like the Soviet Union (SU) and Yugoslavia (YU). Furthermore there are Emoji for the flags of Antarctica (AQ), the European Union (EU) and the United Nations (UN).unicode-tricksConvert the given two characters that represent a flag according to the ISO 3166 Alpha-2 standard to a . If the flag does not exists, then the result is unspecified. One can pass characters in upper case (A-Z) and lower case (a-z). The flag will hold the upper case variant. The Emoji have flags for the countries defined by the ISO 3166 Alpha-2 standard without deprecated regions like the Soviet Union (SU) and Yugoslavia (YU). Furthermore there are Emoji for the flags of Antarctica (AQ), the European Union (EU) and the United Nations (UN).unicode-tricks1Obtain the two-characters that specify the given /. These two characters are always upper case (A-Z).unicode-tricks Generate the < object that is the closest to the given hours and minutes.unicode-tricks Construct a . object with the given number of hours, and a ean that indicates if it is half past that hour. The function will ensure that the hours are between 0 and 12 (both inclusive). For half past 12, we use half past 0, for 12 hours, we use simply 12.unicode-tricksConvert the given Fitzpatrick skin type to the corresponding  wrapped in a  , if no such  exists,  is returned.unicode-tricksConvert the given two acters of the ISO3166-1 Alpha-2 standard to an Emoji that renders the flag of the corresponding country or terroitory. Deprecated regions, such as SU (Soviet Union) and YU (Yugoslavia) have no flag. The European Union (EU), Antarctica (AQ) and United Nations (UN) are included as marcoregion flags. This function does not check if the two characters map to a valid flag token.unicode-tricksConvert the given two acters of the ISO3166-1 Alpha-2 standard to an Emoji that renders the flag of the corresponding country or terroitory wrapped in a  data constructor. Deprecated regions, such as SU (Soviet Union) and YU (Yugoslavia) have no flag. The European Union (EU), Antarctica (AQ) and United Nations (UN) are included as marcoregion flags. If the flag does not exists,  is returned.unicode-tricksCheck if for the given two acters, a flag emoji exists. The two character combinations for which a flag exist are defined in the ISO3166-1 Alpha-2 standard where deprecated reagions, such as SU and YU have no flag, and the European Union (EU), Antarctica (AQ), and the United Nations (UN) have a flag. The characters can be upper case (A-Z) or lower case (a-z). unicode-tricks5The first character of the ISO 3166 Alpha-2 standard.unicode-tricks6The second character of the ISO 3166 Alpha-2 standard.unicode-tricksA  object wrapped in a + data constructor, given such flag exists;  otherwise.unicode-tricks5The first character of the ISO 3166 Alpha-2 standard.unicode-tricks6The second character of the ISO 3166 Alpha-2 standard.unicode-tricksThe equivalent  object.unicode-tricks The given  to convert to a 2-tuple of acters.unicode-tricks#A 2-tuple that contains upper case acters for the given .unicode-tricksThe number of hours.unicode-tricks0The number of minutes, must be between 0 and 60.unicode-tricksThe clock object that is the closest to the given hours and minutes.unicode-tricksThe given hour of the clock, can be any value, but will be set between 1 and 12.unicode-tricksA 4ean that indicates if it is half past that hour, so  means we add 30 minutes.unicode-tricksA clock object that represents the time that is passed through an hour and .unicode-tricks The given Fitzpatrick skin type.unicode-tricksThe corresponding  wrapped in a ;  if no such modifier exists.unicode-tricks The first "acter of the ISO3166 Alpha-2 code.unicode-tricks The second "acter of the ISO3166 Alpha-2 code.unicode-tricksA  object that consists of two characters, where the two characters form a flag emoji, if the given flag exists.unicode-tricks The first "acter of the ISO3166 Alpha-2 code.unicode-tricks The second "acter of the ISO3166 Alpha-2 code.unicode-tricksA  object that consists of two characters, where the two characters form a flag emoji wrapped in a , if the given flag exists;  otherwise.unicode-tricks The first "acter of the ISO3166 Alpha-2 code.unicode-tricks The second "acter of the ISO3166 Alpha-2 code.unicode-tricks2 if a flag emoji exists for the given characters;  otherwise.:A module used to render frames with light and heavy lines.hapytexeu+gh@gmail.com experimentalPOSIXSafe567>unicode-tricksThe given character to convert to its superscript counterpart.unicode-tricksA character wrapped in a  given the counterpart exists,  otherwise.unicode-tricks?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[[\]^_`abcdeffghijklmnnopqrstuvwxyz{|}~                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ssrr    !!!!"""""""""""""""""""""""""""""""""""""""""""""""""##########&&&&&&&&%%%%%%%%&-unicode-tricks-0.9.0.0-E6ysAU75g915yBkV0JxmIuData.Char.ControlData.Char.CoreData.Char.BracketsData.Char.CombiningData.Char.ChessData.Char.CardData.Char.BlockData.Char.BrailleData.Char.BallotBoxData.Char.DiceData.Char.DominoData.Char.EgyptianData.Char.EnclosedData.Char.EmojiData.Char.FrameData.Char.Math.FrakturData.Char.Math.DoubleStruckData.Char.Math.MonospaceData.Char.Math.SansSerif.DigitData.Char.Math.SansSerif.GreekData.Char.Math.SansSerif.LatinData.Char.Math.SansSerifData.Char.Math.ScriptData.Char.Math.Serif.DigitData.Char.Math.Serif.GreekData.Char.Math.Serif.LatinData.Char.Math.SerifData.Char.MathData.Char.Number.DuodecimalData.Char.Number.EgyptianData.Char.Number.RomanData.Char.Number.SegmentedData.Char.PrivateData.Char.Private.KlingonData.Char.SmallData.Char.InternalData.Char.Math.Internalbase GHC.Unicode isControl isAlphaNumisAlphaisAsciiGHC.CharchrGHC.Baseord BracketTypeOpenClose bracketMapsbrackets openBrackets closeBracketstoClosetoOpen isBracket isOpenBracketisCloseBracket bracketType bracketType'getOppositeChargetOppositeChar'$fArbitraryBracketType$fBoundedBracketType$fEnumBracketType$fEqBracketType$fOrdBracketType$fReadBracketType$fShowBracketTypeisAsciiControlhasControlVisualization blankSymbolopenBoxnewLinealternativeDeletealternativeSubstitutecontrolPicturecontrolPicture'fromControlPicturefromControlPicture' UnicodeText toUnicodeTextfromUnicodeTextfromUnicodeText'UnicodeCharacter toUnicodeCharfromUnicodeCharfromUnicodeChar' UnicodeCharLigateNoLigate FontStyle SansSerifSerif ItalicTypeNoItalicItalicEmphasisNoBoldBoldRotatedrobjectrotationRotate90R0R90R180R270Orientedoobject orientation Orientation HorizontalVertical PlusStyle WithoutPlusWithPlus LetterCase UpperCase LowerCasesplitLetterCasesplitPlusStyle splitEmphasissplitItalicTypesplitFontStyle splitLigateligateligateF isAsciiAlphaisAsciiAlphaNumisGreekwithSignsignValueSystempositionalNumberSystempositionalNumberSystem10 isNotReserved isReserved isACharacterisNotACharacter mapToEnum mapToEnumSafe mapFromEnumliftNumberFromliftNumberFrom' liftNumber liftNumber' liftDigit liftDigit' liftUppercaseliftUppercase' liftLowercaseliftLowercase'liftUpperLowercaseliftUpperLowercase'$fDefaultLetterCase$fArbitraryLetterCase$fDefaultPlusStyle$fArbitraryPlusStyle$fArbitraryOrientation$fArbitrary1Oriented$fArbitraryOriented$fArbitraryRotate90$fArbitrary1Rotated$fArbitraryRotated$fDefaultEmphasis$fArbitraryEmphasis$fDefaultItalicType$fArbitraryItalicType$fDefaultFontStyle$fArbitraryFontStyle$fDefaultLigate$fArbitraryLigate$fUnicodeCharacterChar$fUnicodeTextText$fUnicodeTextChar$fUnicodeText[]$fBoundedLigate $fEnumLigate $fEqLigate $fOrdLigate $fReadLigate $fShowLigate$fBoundedFontStyle$fEnumFontStyle $fEqFontStyle$fOrdFontStyle$fReadFontStyle$fShowFontStyle$fBoundedItalicType$fEnumItalicType$fEqItalicType$fOrdItalicType$fReadItalicType$fShowItalicType$fBoundedEmphasis$fEnumEmphasis $fEqEmphasis $fOrdEmphasis$fReadEmphasis$fShowEmphasis$fBoundedRotated $fEqRotated$fFoldableRotated$fFunctorRotated $fOrdRotated $fReadRotated $fShowRotated$fTraversableRotated$fBoundedRotate90$fEnumRotate90 $fEqRotate90 $fOrdRotate90$fReadRotate90$fShowRotate90$fBoundedOriented $fEqOriented$fFoldableOriented$fFunctorOriented $fOrdOriented$fReadOriented$fShowOriented$fTraversableOriented$fBoundedOrientation$fEnumOrientation$fEqOrientation$fOrdOrientation$fReadOrientation$fShowOrientation$fBoundedPlusStyle$fEnumPlusStyle $fEqPlusStyle$fOrdPlusStyle$fReadPlusStyle$fShowPlusStyle$fBoundedLetterCase$fEnumLetterCase$fEqLetterCase$fOrdLetterCase$fReadLetterCase$fShowLetterCase ApplyCombine*^*^!CombiningSequence CombiningCharCombiningCharacterCombiningGraveAccentCombiningAcuteAccentCombiningCircumflexAccentCombiningTildeCombiningMacronCombiningOverlineCombiningBreveCombiningDotAboveCombiningDiaeresisCombiningHookAboveCombiningRingAboveCombiningDoubleAcuteAccentCombiningCaronCombiningVerticalLineAbove CombiningDoubleVerticalLineAboveCombiningDoubleGraveAccentCombiningCandrabinduCombiningInvertedBreveCombiningTurnedCommaAboveCombiningCommaAboveCombiningReversedCommaAboveCombiningCommaAboveRightCombiningGraveAccentBelowCombiningAcuteAccentBelowCombiningLeftTackBelowCombiningRightTackBelowCombiningLeftAngleAbove CombiningHornCombiningLeftHalfRingBelowCombiningUpTackBelowCombiningDownTackBelowCombiningPlusSignBelowCombiningMinusSignBelowCombiningPalatalizedHookBelowCombiningRetroflexHookBelowCombiningDotBelowCombiningDiaeresisBelowCombiningRingBelowCombiningCommaBelowCombiningCedillaCombiningOgonekCombiningVerticalLineBelowCombiningBridgeBelow CombiningInvertedDoubleArchBelowCombiningCaronBelowCombiningCircumflexAccentBelowCombiningBreveBelowCombiningInvertedBreveBelowCombiningTildeBelowCombiningMacronBelowCombiningLowLineCombiningDoubleLowLineCombiningTildeOverlayCombiningShortStrokeOverlayCombiningLongStrokeOverlayCombiningShortSolidusOverlayCombiningLongSolidusOverlayCombiningRightHalfRingBelowCombiningInvertedBridgeBelowCombiningSquareBelowCombiningSeagullBelowCombiningXAboveCombiningVerticalTildeCombiningDoubleOverlineCombiningGraveToneMarkCombiningAcuteToneMarkCombiningGreekPerispomeniCombiningGreekKoronisCombiningGreekDialytikaTonosCombiningGreekYpogegrammeniCombiningBridgeAboveCombiningEqualsSignBelow CombiningDoubleVerticalLineBelowCombiningLeftAngleBelowCombiningNotTildeAboveCombiningHomotheticAboveCombiningAlmostEqualToAboveCombiningLeftRightArrowBelowCombiningUpwardsArrowBelowCombiningRightArrowheadAboveCombiningLeftHalfRingAboveCombiningFermataCombiningXBelowCombiningLeftArrowheadBelowCombiningRightArrowheadBelow*CombiningRightArrowheadAndUpArrowheadBelowCombiningRightHalfRingAboveCombiningDotAboveRightCombiningAsteriskBelowCombiningDoubleRingBelowCombiningZigzagAboveCombiningDoubleBreveBelowCombiningDoubleBreveCombiningDoubleMacronCombiningDoubleMacronBelowCombiningDoubleTildeCombiningDoubleInvertedBreve#CombiningDoubleRightwardsArrowBelowCombiningLatinSmallLetterACombiningLatinSmallLetterECombiningLatinSmallLetterICombiningLatinSmallLetterOCombiningLatinSmallLetterUCombiningLatinSmallLetterCCombiningLatinSmallLetterDCombiningLatinSmallLetterHCombiningLatinSmallLetterMCombiningLatinSmallLetterRCombiningLatinSmallLetterTCombiningLatinSmallLetterVCombiningLatinSmallLetterXCombiningCyrillicTitloCombiningCyrillicPalatalizationCombiningCyrillicDasiaPneumataCombiningCyrillicPsiliPneumataCombiningCyrillicPokrytieHebrewAccentEtnahtaHebrewAccentSegolHebrewAccentShalsheletHebrewAccentZaqefQatanHebrewAccentZaqefGadolHebrewAccentTipehaHebrewAccentReviaHebrewAccentZarqaHebrewAccentPashtaHebrewAccentYetivHebrewAccentTevirHebrewAccentGereshHebrewAccentGereshMuqdamHebrewAccentGershayimHebrewAccentQarneyParaHebrewAccentTelishaGedolaHebrewAccentPazerHebrewAccentAtnahHafukhHebrewAccentMunahHebrewAccentMahapakhHebrewAccentMerkhaHebrewAccentMerkhaKefulaHebrewAccentDargaHebrewAccentQadmaHebrewAccentTelishaQetanaHebrewAccentYerahBenYomoHebrewAccentOleHebrewAccentIluyHebrewAccentDehiHebrewAccentZinorHebrewMarkMasoraCircleHebrewPointShevaHebrewPointHatafSegolHebrewPointHatafPatahHebrewPointHatafQamatsHebrewPointHiriqHebrewPointTsereHebrewPointSegolHebrewPointPatahHebrewPointQamatsHebrewPointHolamHebrewPointHolamHaserForVavHebrewPointQubutsHebrewPointDageshOrMapiqHebrewPointMetegHebrewPointRafeHebrewPointShinDotHebrewPointSinDotHebrewMarkUpperDotHebrewMarkLowerDotHebrewPointQamatsQatan$ArabicSignSallallahouAlayheWassallamArabicSignAlayheAssallamArabicSignRahmatullahAlayheArabicSignRadiAllahouAnhuArabicSignTakhallusArabicSmallHighTah)ArabicSmallHighLigatureAlefWithLamWithYehArabicSmallHighZainArabicSmallFathaArabicSmallDammaArabicSmallKasraArabicFathatanArabicDammatanArabicKasratan ArabicFatha ArabicDamma ArabicKasra ArabicShadda ArabicSukunArabicMaddahAboveArabicHamzaAboveArabicHamzaBelowArabicSubscriptAlefArabicInvertedDammaArabicMarkNoonGhunnaArabicZwarakayArabicVowelSignSmallVAbove"ArabicVowelSignInvertedSmallVAboveArabicVowelSignDotBelowArabicReversedDammaArabicFathaWithTwoDotsArabicWavyHamzaBelowArabicLetterSuperscriptAlef0ArabicSmallHighLigatureSadWithLamWithAlefMaksura0ArabicSmallHighLigatureQafWithLamWithAlefMaksuraArabicSmallHighMeemInitialFormArabicSmallHighLamAlefArabicSmallHighJeemArabicSmallHighThreeDotsArabicSmallHighSeenArabicSmallHighRoundedZero%ArabicSmallHighUprightRectangularZero ArabicSmallHighDotlessHeadOfKhahArabicSmallHighMeemIsolatedFormArabicSmallLowSeenArabicSmallHighMaddaArabicSmallHighYehArabicSmallHighNoonArabicEmptyCentreLowStopArabicEmptyCentreHighStop%ArabicRoundedHighStopWithFilledCentreArabicSmallLowMeemSyriacLetterSuperscriptAlaphSyriacPthahaAboveSyriacPthahaBelowSyriacPthahaDottedSyriacZqaphaAboveSyriacZqaphaBelowSyriacZqaphaDottedSyriacRbasaAboveSyriacRbasaBelowSyriacDottedZlamaHorizontalSyriacDottedZlamaAngularSyriacHbasaAboveSyriacHbasaBelowSyriacHbasaEsasaDottedSyriacEsasaAboveSyriacEsasaBelow SyriacRwahaSyriacFeminineDotSyriacQushshayaSyriacRukkakhaSyriacTwoVerticalDotsAboveSyriacTwoVerticalDotsBelowSyriacThreeDotsAboveSyriacThreeDotsBelowSyriacObliqueLineAboveSyriacObliqueLineBelow SyriacMusic SyriacBarrekhNkoCombiningShortHighToneNkoCombiningShortLowToneNkoCombiningShortRisingToneNkoCombiningLongDescendingToneNkoCombiningLongHighToneNkoCombiningLongLowToneNkoCombiningLongRisingToneNkoCombiningNasalizationMarkNkoCombiningDoubleDotAboveSamaritanMarkInSamaritanMarkInAlafSamaritanMarkOcclusionSamaritanMarkDageshSamaritanMarkEpentheticYutSamaritanVowelSignLongESamaritanVowelSignESamaritanVowelSignOverlongAaSamaritanVowelSignLongAaSamaritanVowelSignAaSamaritanVowelSignOverlongASamaritanVowelSignLongASamaritanVowelSignASamaritanVowelSignShortASamaritanVowelSignLongUSamaritanVowelSignUSamaritanVowelSignLongISamaritanVowelSignISamaritanVowelSignOSamaritanVowelSignSukunSamaritanMarkNequdaaMandaicAffricationMarkMandaicVocalizationMarkMandaicGeminationMarkArabicSmallHighWordArRubArabicSmallHighSadArabicSmallHighAinArabicSmallHighQafArabicSmallHighNoonWithKasraArabicSmallLowNoonWithKasraArabicSmallHighWordAthThalathaArabicSmallHighWordAsSajdaArabicSmallHighWordAnNisfArabicSmallHighWordSaktaArabicSmallHighWordQifArabicSmallHighWordWaqfaArabicSmallHighFootnoteMarkerArabicSmallHighSignSafhaArabicTurnedDammaBelowArabicCurlyFathaArabicCurlyDammaArabicCurlyKasraArabicCurlyFathatanArabicCurlyDammatanArabicCurlyKasratanArabicToneOneDotAboveArabicToneTwoDotsAboveArabicToneLoopAboveArabicToneOneDotBelowArabicToneTwoDotsBelowArabicToneLoopBelowArabicOpenFathatanArabicOpenDammatanArabicOpenKasratanArabicSmallHighWawArabicFathaWithRingArabicFathaWithDotAboveArabicKasraWithDotBelowArabicLeftArrowheadAboveArabicRightArrowheadAboveArabicLeftArrowheadBelowArabicRightArrowheadBelowArabicDoubleRightArrowheadAbove&ArabicDoubleRightArrowheadAboveWithDot ArabicRightArrowheadAboveWithDotArabicDammaWithDotArabicMarkSidewaysNoonGhunnaDevanagariSignNuktaDevanagariSignViramaDevanagariStressSignUdattaDevanagariStressSignAnudattaDevanagariGraveAccentDevanagariAcuteAccentBengaliSignNuktaBengaliVowelSignAaBengaliSignViramaBengaliAuLengthMarkGurmukhiSignNuktaGurmukhiSignViramaGujaratiSignNuktaGujaratiSignViramaOriyaSignNuktaOriyaVowelSignAaOriyaSignViramaOriyaAiLengthMarkOriyaAuLengthMarkTamilVowelSignAaTamilSignViramaTamilAuLengthMarkTeluguSignViramaTeluguLengthMarkTeluguAiLengthMarkKannadaSignNuktaKannadaVowelSignUuKannadaSignViramaKannadaLengthMarkKannadaAiLengthMarkMalayalamVowelSignAaMalayalamSignViramaMalayalamAuLengthMarkSinhalaSignAlLakunaSinhalaVowelSignAelaPillaSinhalaVowelSignGayanukittaThaiCharacterSaraUThaiCharacterSaraUuThaiCharacterPhinthuThaiCharacterMaiEkThaiCharacterMaiThoThaiCharacterMaiTriThaiCharacterMaiChattawa LaoVowelSignULaoVowelSignUu LaoToneMaiEk LaoToneMaiTho LaoToneMaiTiLaoToneMaiCatawaTibetanAstrologicalSignKhyudPa"TibetanAstrologicalSignSdongTshugsTibetanMarkNgasBzungNyiZlaTibetanMarkNgasBzungSgorRtagsTibetanMarkTsaPhruTibetanVowelSignAaTibetanVowelSignITibetanVowelSignUTibetanVowelSignETibetanVowelSignEeTibetanVowelSignOTibetanVowelSignOoTibetanVowelSignReversedITibetanSignNyiZlaNaaDaTibetanSignSnaLdanTibetanMarkHalantaTibetanSignLciRtagsTibetanSignYangRtagsTibetanSubjoinedLetterSsaTibetanSubjoinedLetterHaTibetanSymbolPadmaGdanMyanmarVowelSignIiMyanmarSignDotBelowMyanmarSignViramaMyanmarSignAsat"MyanmarSignShanCouncilEmphaticTone-EthiopicCombiningGeminationAndVowelLengthMark EthiopicCombiningVowelLengthMarkEthiopicCombiningGeminationMarkTagalogSignViramaHanunooSignPamudpodKhmerSignCoengKhmerSignAtthacanMongolianLetterAliGaliDagalgaLimbuSignMukphrengLimbuSignKemphreng LimbuSignSaIBugineseVowelSignIBugineseVowelSignUTaiThamSignSakotTaiThamSignTone1TaiThamSignTone2TaiThamSignKhuenTone3TaiThamSignKhuenTone4TaiThamSignKhuenTone5TaiThamSignRaHaamTaiThamSignMaiSamTaiThamSignKhuenLueKaran TaiThamCombiningCryptogrammicDot CombiningDoubledCircumflexAccentCombiningDiaeresisRingCombiningInfinityCombiningDownwardsArrowCombiningTripleDotCombiningXXBelowCombiningWigglyLineBelowCombiningOpenMarkBelowCombiningDoubleOpenMarkBelow'CombiningLightCentralizationStrokeBelow(CombiningStrongCentralizationStrokeBelowCombiningParenthesesAboveCombiningDoubleParenthesesAboveCombiningParenthesesBelowBalineseSignRerekanBalineseVowelSignTedungBalineseAdegAdeg#BalineseMusicalSymbolCombiningTegeh#BalineseMusicalSymbolCombiningEndep$BalineseMusicalSymbolCombiningKempul$BalineseMusicalSymbolCombiningKempli%BalineseMusicalSymbolCombiningJegogan/BalineseMusicalSymbolCombiningKempulWithJegogan/BalineseMusicalSymbolCombiningKempliWithJegogan#BalineseMusicalSymbolCombiningBende"BalineseMusicalSymbolCombiningGongSundaneseSignPamaaehSundaneseSignViramaBatakSignTompi BatakPangolatBatakPanongonanLepchaSignNuktaVedicToneKarshanaVedicToneSharaVedicTonePrenkha!VedicSignYajurvedicMidlineSvarita/VedicToneYajurvedicAggravatedIndependentSvarita%VedicToneYajurvedicIndependentSvarita,VedicToneYajurvedicKathakaIndependentSvaritaVedicToneCandraBelow5VedicToneYajurvedicKathakaIndependentSvaritaSchroederVedicToneDoubleSvaritaVedicToneTripleSvaritaVedicToneKathakaAnudattaVedicToneDotBelowVedicToneTwoDotsBelowVedicToneThreeDotsBelow+VedicToneRigvedicKashmiriIndependentSvaritaVedicSignVisargaSvaritaVedicSignVisargaUdattaVedicSignReversedVisargaUdattaVedicSignVisargaAnudatta VedicSignReversedVisargaAnudattaVedicSignVisargaUdattaWithTail VedicSignVisargaAnudattaWithTailVedicSignTiryakVedicToneCandraAboveVedicToneRingAboveVedicToneDoubleRingAboveCombiningDottedGraveAccentCombiningDottedAcuteAccentCombiningSnakeBelowCombiningSuspensionMarkCombiningMacronAcuteCombiningGraveMacronCombiningMacronGraveCombiningAcuteMacronCombiningGraveAcuteGraveCombiningAcuteGraveAcuteCombiningLatinSmallLetterRBelowCombiningBreveMacronCombiningMacronBreveCombiningDoubleCircumflexAboveCombiningOgonekAboveCombiningZigzagBelowCombiningIsBelowCombiningUrAboveCombiningUsAbove,CombiningLatinSmallLetterFlattenedOpenAAboveCombiningLatinSmallLetterAeCombiningLatinSmallLetterAoCombiningLatinSmallLetterAv!CombiningLatinSmallLetterCCedilla!CombiningLatinSmallLetterInsularDCombiningLatinSmallLetterEthCombiningLatinSmallLetterG!CombiningLatinLetterSmallCapitalGCombiningLatinSmallLetterKCombiningLatinSmallLetterL!CombiningLatinLetterSmallCapitalL!CombiningLatinLetterSmallCapitalMCombiningLatinSmallLetterN!CombiningLatinLetterSmallCapitalN!CombiningLatinLetterSmallCapitalR!CombiningLatinSmallLetterRRotundaCombiningLatinSmallLetterSCombiningLatinSmallLetterLongSCombiningLatinSmallLetterZCombiningLatinSmallLetterAlphaCombiningLatinSmallLetterBCombiningLatinSmallLetterBetaCombiningLatinSmallLetterSchwaCombiningLatinSmallLetterF/CombiningLatinSmallLetterLWithDoubleMiddleTilde7CombiningLatinSmallLetterOWithLightCentralizationStrokeCombiningLatinSmallLetterPCombiningLatinSmallLetterEsh7CombiningLatinSmallLetterUWithLightCentralizationStrokeCombiningLatinSmallLetterW'CombiningLatinSmallLetterAWithDiaeresis'CombiningLatinSmallLetterOWithDiaeresis'CombiningLatinSmallLetterUWithDiaeresisCombiningUpTackAboveCombiningDeletionMark!CombiningDoubleInvertedBreveBelowCombiningAlmostEqualToBelowCombiningLeftArrowheadAbove,CombiningRightArrowheadAndDownArrowheadBelowCombiningLeftHarpoonAboveCombiningRightHarpoonAbove CombiningLongVerticalLineOverlay!CombiningShortVerticalLineOverlay CombiningAnticlockwiseArrowAboveCombiningClockwiseArrowAboveCombiningLeftArrowAboveCombiningRightArrowAboveCombiningRingOverlayCombiningClockwiseRingOverlay!CombiningAnticlockwiseRingOverlayCombiningThreeDotsAboveCombiningFourDotsAboveCombiningLeftRightArrowAboveCombiningReverseSolidusOverlay$CombiningDoubleVerticalStrokeOverlayCombiningAnnuitySymbolCombiningTripleUnderdotCombiningWideBridgeAboveCombiningLeftwardsArrowOverlay!CombiningLongDoubleSolidusOverlay+CombiningRightwardsHarpoonWithBarbDownwards*CombiningLeftwardsHarpoonWithBarbDownwardsCombiningLeftArrowBelowCombiningRightArrowBelowCombiningAsteriskAboveCopticCombiningNiAboveCopticCombiningSpiritusAsperCopticCombiningSpiritusLenisTifinaghConsonantJoinerCombiningCyrillicLetterBeCombiningCyrillicLetterVeCombiningCyrillicLetterGheCombiningCyrillicLetterDeCombiningCyrillicLetterZheCombiningCyrillicLetterZeCombiningCyrillicLetterKaCombiningCyrillicLetterElCombiningCyrillicLetterEmCombiningCyrillicLetterEnCombiningCyrillicLetterOCombiningCyrillicLetterPeCombiningCyrillicLetterErCombiningCyrillicLetterEsCombiningCyrillicLetterTeCombiningCyrillicLetterHaCombiningCyrillicLetterTseCombiningCyrillicLetterCheCombiningCyrillicLetterShaCombiningCyrillicLetterShchaCombiningCyrillicLetterFitaCombiningCyrillicLetterEsTeCombiningCyrillicLetterACombiningCyrillicLetterIeCombiningCyrillicLetterDjerv"CombiningCyrillicLetterMonographUkCombiningCyrillicLetterYatCombiningCyrillicLetterYu CombiningCyrillicLetterIotifiedA CombiningCyrillicLetterLittleYusCombiningCyrillicLetterBigYus%CombiningCyrillicLetterIotifiedBigYusIdeographicLevelToneMarkIdeographicRisingToneMarkIdeographicDepartingToneMarkIdeographicEnteringToneMarkHangulSingleDotToneMarkHangulDoubleDotToneMark(CombiningKatakanaHiraganaVoicedSoundMark,CombiningKatakanaHiraganaSemiVoicedSoundMarkCombiningCyrillicVzmet"CombiningCyrillicLetterUkrainianIeCombiningCyrillicLetterICombiningCyrillicLetterYiCombiningCyrillicLetterUCombiningCyrillicLetterHardSignCombiningCyrillicLetterYeruCombiningCyrillicLetterSoftSignCombiningCyrillicLetterOmegaCombiningCyrillicKavykaCombiningCyrillicPayerokCombiningCyrillicLetterEf CombiningCyrillicLetterIotifiedEBamumCombiningMarkKoqndonBamumCombiningMarkTukwentisSylotiNagriSignHasantaSaurashtraSignViramaCombiningDevanagariDigitZeroCombiningDevanagariDigitOneCombiningDevanagariDigitTwoCombiningDevanagariDigitThreeCombiningDevanagariDigitFourCombiningDevanagariDigitFiveCombiningDevanagariDigitSixCombiningDevanagariDigitSevenCombiningDevanagariDigitEightCombiningDevanagariDigitNineCombiningDevanagariLetterACombiningDevanagariLetterUCombiningDevanagariLetterKaCombiningDevanagariLetterNaCombiningDevanagariLetterPaCombiningDevanagariLetterRaCombiningDevanagariLetterViCombiningDevanagariSignAvagrahaKayahLiTonePlophuKayahLiToneCalyaKayahLiToneCalyaPlophu RejangViramaJavaneseSignCecakTeluJavanesePangkonTaiVietMaiKang TaiVietVowelITaiVietVowelUe TaiVietVowelUTaiVietMaiKhitTaiVietVowelIaTaiVietVowelAmTaiVietToneMaiEkTaiVietToneMaiThoMeeteiMayekViramaMeeteiMayekApunIyekHebrewPointJudeoSpanishVarikaCombiningLigatureLeftHalfCombiningLigatureRightHalfCombiningDoubleTildeLeftHalfCombiningDoubleTildeRightHalfCombiningMacronLeftHalfCombiningMacronRightHalfCombiningConjoiningMacronCombiningLigatureLeftHalfBelowCombiningLigatureRightHalfBelowCombiningTildeLeftHalfBelowCombiningTildeRightHalfBelowCombiningMacronLeftHalfBelowCombiningMacronRightHalfBelowCombiningConjoiningMacronBelowCombiningCyrillicTitloLeftHalfCombiningCyrillicTitloRightHalf&PhaistosDiscSignCombiningObliqueStrokeCopticEpactThousandsMarkCombiningOldPermicLetterAnCombiningOldPermicLetterDoiCombiningOldPermicLetterZataCombiningOldPermicLetterNenoeCombiningOldPermicLetterSiiKharoshthiSignDoubleRingBelowKharoshthiSignVisargaKharoshthiSignBarAboveKharoshthiSignCaudaKharoshthiSignDotBelowKharoshthiViramaManichaeanAbbreviationMarkAboveManichaeanAbbreviationMarkBelow BrahmiViramaBrahmiNumberJoinerKaithiSignViramaKaithiSignNuktaChakmaSignCandrabinduChakmaSignAnusvaraChakmaSignVisargaChakmaVowelSignA ChakmaVirama ChakmaMaayyaaMahajaniSignNuktaSharadaSignViramaSharadaSignNuktaKhojkiSignViramaKhojkiSignNuktaKhudawadiSignNuktaKhudawadiSignViramaGranthaSignNuktaGranthaVowelSignAaGranthaSignViramaGranthaAuLengthMarkCombiningGranthaDigitZeroCombiningGranthaDigitOneCombiningGranthaDigitTwoCombiningGranthaDigitThreeCombiningGranthaDigitFourCombiningGranthaDigitFiveCombiningGranthaDigitSixCombiningGranthaLetterACombiningGranthaLetterKaCombiningGranthaLetterNaCombiningGranthaLetterViCombiningGranthaLetterPaNewaSignVirama NewaSignNuktaTirhutaVowelSignAaTirhutaVowelSignShortETirhutaVowelSignShortOTirhutaSignViramaTirhutaSignNuktaSiddhamVowelSignAaSiddhamSignViramaSiddhamSignNuktaModiSignViramaTakriSignViramaTakriSignNuktaAhomSignKillerBhaiksukiSignViramaBassaVahCombiningHighToneBassaVahCombiningLowToneBassaVahCombiningMidToneBassaVahCombiningLowMidToneBassaVahCombiningHighLowTonePahawhHmongMarkCimTubPahawhHmongMarkCimSoPahawhHmongMarkCimKesPahawhHmongMarkCimKhavPahawhHmongMarkCimSuamPahawhHmongMarkCimHomPahawhHmongMarkCimTaumDuployanDoubleMarkMusicalSymbolCombiningStem&MusicalSymbolCombiningSprechgesangStemMusicalSymbolCombiningTremolo1MusicalSymbolCombiningTremolo2MusicalSymbolCombiningTremolo3%MusicalSymbolCombiningAugmentationDotMusicalSymbolCombiningFlag1MusicalSymbolCombiningFlag2MusicalSymbolCombiningFlag3MusicalSymbolCombiningFlag4MusicalSymbolCombiningFlag5MusicalSymbolCombiningAccentMusicalSymbolCombiningStaccatoMusicalSymbolCombiningTenuto#MusicalSymbolCombiningStaccatissimoMusicalSymbolCombiningMarcato%MusicalSymbolCombiningMarcatoStaccato$MusicalSymbolCombiningAccentStaccatoMusicalSymbolCombiningLoureMusicalSymbolCombiningDoitMusicalSymbolCombiningRipMusicalSymbolCombiningFlipMusicalSymbolCombiningSmearMusicalSymbolCombiningBend"MusicalSymbolCombiningDoubleTongue"MusicalSymbolCombiningTripleTongueMusicalSymbolCombiningDownBowMusicalSymbolCombiningUpBowMusicalSymbolCombiningHarmonic#MusicalSymbolCombiningSnapPizzicatoCombiningGreekMusicalTrisemeCombiningGreekMusicalTetrasemeCombiningGreekMusicalPentasemeCombiningGlagoliticLetterAzuCombiningGlagoliticLetterBukyCombiningGlagoliticLetterVede CombiningGlagoliticLetterGlagoliCombiningGlagoliticLetterDobroCombiningGlagoliticLetterYestu CombiningGlagoliticLetterZhiveteCombiningGlagoliticLetterZemljaCombiningGlagoliticLetterIzhe$CombiningGlagoliticLetterInitialIzheCombiningGlagoliticLetterICombiningGlagoliticLetterDjerviCombiningGlagoliticLetterKako CombiningGlagoliticLetterLjudije CombiningGlagoliticLetterMysliteCombiningGlagoliticLetterNashiCombiningGlagoliticLetterOnuCombiningGlagoliticLetterPokojiCombiningGlagoliticLetterRitsiCombiningGlagoliticLetterSlovoCombiningGlagoliticLetterTvridoCombiningGlagoliticLetterUkuCombiningGlagoliticLetterFrituCombiningGlagoliticLetterHeruCombiningGlagoliticLetterShtaCombiningGlagoliticLetterTsiCombiningGlagoliticLetterChriviCombiningGlagoliticLetterShaCombiningGlagoliticLetterYeruCombiningGlagoliticLetterYeriCombiningGlagoliticLetterYatiCombiningGlagoliticLetterYu!CombiningGlagoliticLetterSmallYusCombiningGlagoliticLetterYo(CombiningGlagoliticLetterIotatedSmallYusCombiningGlagoliticLetterBigYus&CombiningGlagoliticLetterIotatedBigYusCombiningGlagoliticLetterFita MendeKikakuiCombiningNumberTeensMendeKikakuiCombiningNumberTens#MendeKikakuiCombiningNumberHundreds$MendeKikakuiCombiningNumberThousands'MendeKikakuiCombiningNumberTenThousands+MendeKikakuiCombiningNumberHundredThousands#MendeKikakuiCombiningNumberMillionsAdlamAlifLengthenerAdlamVowelLengthenerAdlamGeminationMark AdlamHamzaAdlamConsonantModifierAdlamGeminateConsonantModifier AdlamNuktaMendeKikakuiNumberMillions"MendeKikakuiNumberHundredThousandsMendeKikakuiNumberTenThousandsMendeKikakuiNumberThousandsMendeKikakuiNumberHundredsMendeKikakuiNumberTensMendeKikakuiNumberTeensGlagoliticLetterFitaGlagoliticLetterIotatedBigYusGlagoliticLetterBigYusGlagoliticLetterIotatedSmallYusGlagoliticLetterYoGlagoliticLetterSmallYusGlagoliticLetterYuGlagoliticLetterYatiGlagoliticLetterYeriGlagoliticLetterYeruGlagoliticLetterShaGlagoliticLetterChriviGlagoliticLetterTsiGlagoliticLetterShtaGlagoliticLetterHeruGlagoliticLetterFrituGlagoliticLetterUkuGlagoliticLetterTvridoGlagoliticLetterSlovoGlagoliticLetterRitsiGlagoliticLetterPokojiGlagoliticLetterOnuGlagoliticLetterNashiGlagoliticLetterMysliteGlagoliticLetterLjudijeGlagoliticLetterKakoGlagoliticLetterDjerviGlagoliticLetterIGlagoliticLetterInitialIzheGlagoliticLetterIzheGlagoliticLetterZemljaGlagoliticLetterZhiveteGlagoliticLetterYestuGlagoliticLetterDobroGlagoliticLetterGlagoliGlagoliticLetterVedeGlagoliticLetterBukyGlagoliticLetterAzuGreekMusicalPentasemeGreekMusicalTetrasemeGreekMusicalTrisemeMusicalSymbolSnapPizzicatoMusicalSymbolHarmonicMusicalSymbolUpBowMusicalSymbolDownBowMusicalSymbolTripleTongueMusicalSymbolDoubleTongueMusicalSymbolBendMusicalSymbolSmearMusicalSymbolFlipMusicalSymbolRipMusicalSymbolDoitMusicalSymbolLoureMusicalSymbolAccentStaccatoMusicalSymbolMarcatoStaccatoMusicalSymbolMarcatoMusicalSymbolStaccatissimoMusicalSymbolTenutoMusicalSymbolStaccatoMusicalSymbolAccentMusicalSymbolFlag5MusicalSymbolFlag4MusicalSymbolFlag3MusicalSymbolFlag2MusicalSymbolFlag1MusicalSymbolAugmentationDotMusicalSymbolTremolo3MusicalSymbolTremolo2MusicalSymbolTremolo1MusicalSymbolSprechgesangStemMusicalSymbolStemBassaVahHighLowToneBassaVahLowMidToneBassaVahMidToneBassaVahLowToneBassaVahHighToneGranthaLetterPaGranthaLetterViGranthaLetterNaGranthaLetterKaGranthaLetterAGranthaDigitSixGranthaDigitFiveGranthaDigitFourGranthaDigitThreeGranthaDigitTwoGranthaDigitOneGranthaDigitZeroOldPermicLetterSiiOldPermicLetterNenoeOldPermicLetterZataOldPermicLetterDoiOldPermicLetterAnPhaistosDiscSignObliqueStrokeCyrillicTitloRightHalfCyrillicTitloLeftHalfConjoiningMacronBelowMacronRightHalfBelowMacronLeftHalfBelowTildeRightHalfBelowTildeLeftHalfBelowLigatureRightHalfBelowLigatureLeftHalfBelowConjoiningMacronMacronRightHalfMacronLeftHalfDoubleTildeRightHalfDoubleTildeLeftHalfLigatureRightHalfLigatureLeftHalfDevanagariSignAvagrahaDevanagariLetterViDevanagariLetterRaDevanagariLetterPaDevanagariLetterNaDevanagariLetterKaDevanagariLetterUDevanagariLetterADevanagariDigitNineDevanagariDigitEightDevanagariDigitSevenDevanagariDigitSixDevanagariDigitFiveDevanagariDigitFourDevanagariDigitThreeDevanagariDigitTwoDevanagariDigitOneDevanagariDigitZeroBamumMarkTukwentisBamumMarkKoqndonCyrillicLetterIotifiedECyrillicLetterEfCyrillicPayerokCyrillicKavykaCyrillicLetterOmegaCyrillicLetterSoftSignCyrillicLetterYeruCyrillicLetterHardSignCyrillicLetterUCyrillicLetterYiCyrillicLetterICyrillicLetterUkrainianIe CyrillicVzmet#KatakanaHiraganaSemiVoicedSoundMarkKatakanaHiraganaVoicedSoundMarkCyrillicLetterIotifiedBigYusCyrillicLetterBigYusCyrillicLetterLittleYusCyrillicLetterIotifiedACyrillicLetterYuCyrillicLetterYatCyrillicLetterMonographUkCyrillicLetterDjervCyrillicLetterIeCyrillicLetterACyrillicLetterEsTeCyrillicLetterFitaCyrillicLetterShchaCyrillicLetterShaCyrillicLetterCheCyrillicLetterTseCyrillicLetterHaCyrillicLetterTeCyrillicLetterEsCyrillicLetterErCyrillicLetterPeCyrillicLetterOCyrillicLetterEnCyrillicLetterEmCyrillicLetterElCyrillicLetterKaCyrillicLetterZeCyrillicLetterZheCyrillicLetterDeCyrillicLetterGheCyrillicLetterVeCyrillicLetterBeCopticSpiritusLenisCopticSpiritusAsper CopticNiAbove AsteriskAboveRightArrowBelowLeftArrowBelow!LeftwardsHarpoonWithBarbDownwards"RightwardsHarpoonWithBarbDownwardsLongDoubleSolidusOverlayLeftwardsArrowOverlayWideBridgeAboveTripleUnderdot AnnuitySymbolDoubleVerticalStrokeOverlayReverseSolidusOverlayLeftRightArrowAbove FourDotsAboveThreeDotsAboveAnticlockwiseRingOverlayClockwiseRingOverlay RingOverlayRightArrowAboveLeftArrowAboveClockwiseArrowAboveAnticlockwiseArrowAboveShortVerticalLineOverlayLongVerticalLineOverlayRightHarpoonAboveLeftHarpoonAbove#RightArrowheadAndDownArrowheadBelowLeftArrowheadAboveAlmostEqualToBelowDoubleInvertedBreveBelow DeletionMark UpTackAboveLatinSmallLetterUWithDiaeresisLatinSmallLetterOWithDiaeresisLatinSmallLetterAWithDiaeresisLatinSmallLetterW.LatinSmallLetterUWithLightCentralizationStrokeLatinSmallLetterEshLatinSmallLetterP.LatinSmallLetterOWithLightCentralizationStroke&LatinSmallLetterLWithDoubleMiddleTildeLatinSmallLetterFLatinSmallLetterSchwaLatinSmallLetterBetaLatinSmallLetterBLatinSmallLetterAlphaLatinSmallLetterZLatinSmallLetterLongSLatinSmallLetterSLatinSmallLetterRRotundaLatinLetterSmallCapitalRLatinLetterSmallCapitalNLatinSmallLetterNLatinLetterSmallCapitalMLatinLetterSmallCapitalLLatinSmallLetterLLatinSmallLetterKLatinLetterSmallCapitalGLatinSmallLetterGLatinSmallLetterEthLatinSmallLetterInsularDLatinSmallLetterCCedillaLatinSmallLetterAvLatinSmallLetterAoLatinSmallLetterAe#LatinSmallLetterFlattenedOpenAAboveUsAboveUrAboveIsBelow ZigzagBelow OgonekAboveDoubleCircumflexAbove MacronBreve BreveMacronLatinSmallLetterRBelowAcuteGraveAcuteGraveAcuteGrave AcuteMacron MacronGrave GraveMacron MacronAcuteSuspensionMark SnakeBelowDottedAcuteAccentDottedGraveAccentBalineseMusicalSymbolGongBalineseMusicalSymbolBende&BalineseMusicalSymbolKempliWithJegogan&BalineseMusicalSymbolKempulWithJegoganBalineseMusicalSymbolJegoganBalineseMusicalSymbolKempliBalineseMusicalSymbolKempulBalineseMusicalSymbolEndepBalineseMusicalSymbolTegehParenthesesBelowDoubleParenthesesAboveParenthesesAboveStrongCentralizationStrokeBelowLightCentralizationStrokeBelowDoubleOpenMarkBelow OpenMarkBelowWigglyLineBelowXXBelow TripleDotDownwardsArrowInfinity DiaeresisRingDoubledCircumflexAccentTaiThamCryptogrammicDotEthiopicGeminationMarkEthiopicVowelLengthMark$EthiopicGeminationAndVowelLengthMarkNkoDoubleDotAboveNkoNasalizationMarkNkoLongRisingToneNkoLongLowToneNkoLongHighToneNkoLongDescendingToneNkoShortRisingToneNkoShortLowToneNkoShortHighToneCyrillicPokrytieCyrillicPsiliPneumataCyrillicDasiaPneumataCyrillicPalatalization CyrillicTitloLatinSmallLetterXLatinSmallLetterVLatinSmallLetterTLatinSmallLetterRLatinSmallLetterMLatinSmallLetterHLatinSmallLetterDLatinSmallLetterCLatinSmallLetterULatinSmallLetterOLatinSmallLetterILatinSmallLetterELatinSmallLetterADoubleRightwardsArrowBelowDoubleInvertedBreve DoubleTildeDoubleMacronBelow DoubleMacron DoubleBreveDoubleBreveBelow ZigzagAboveDoubleRingBelow AsteriskBelow DotAboveRightRightHalfRingAbove!RightArrowheadAndUpArrowheadBelowRightArrowheadBelowLeftArrowheadBelowXBelowFermataLeftHalfRingAboveRightArrowheadAboveUpwardsArrowBelowLeftRightArrowBelowAlmostEqualToAboveHomotheticAbove NotTildeAboveLeftAngleBelowDoubleVerticalLineBelowEqualsSignBelow BridgeAboveGreekYpogegrammeniGreekDialytikaTonos GreekKoronisGreekPerispomeni AcuteToneMark GraveToneMarkDoubleOverline VerticalTildeXAbove SeagullBelow SquareBelowInvertedBridgeBelowRightHalfRingBelowLongSolidusOverlayShortSolidusOverlayLongStrokeOverlayShortStrokeOverlay TildeOverlay DoubleLowLineLowLine MacronBelow TildeBelowInvertedBreveBelow BreveBelowCircumflexAccentBelow CaronBelowInvertedDoubleArchBelow BridgeBelowVerticalLineBelowOgonekCedilla CommaBelow RingBelowDiaeresisBelowDotBelowRetroflexHookBelowPalatalizedHookBelowMinusSignBelow PlusSignBelow DownTackBelow UpTackBelowLeftHalfRingBelowHornLeftAngleAboveRightTackBelow LeftTackBelowAcuteAccentBelowGraveAccentBelowCommaAboveRightReversedCommaAbove CommaAboveTurnedCommaAbove InvertedBreve CandrabinduDoubleGraveAccentDoubleVerticalLineAboveVerticalLineAboveCaronDoubleAcuteAccent RingAbove HookAbove DiaeresisDotAboveBreveOverlineMacronTildeCircumflexAccent AcuteAccent GraveAccentcombiningToUnicodeisCombiningCharactercombiningCharacter'combiningCharacterdecomposeCombiningSequencestripCombiningSequencestripCombiningsdecomposeCombiningcomposeCombiningSequencecomposeCombiningSequence'composeCombiningcomposeCombining'$fUnicodeTextCombiningCharacter$$fUnicodeCharacterCombiningCharacter$fArbitraryCombiningCharacter $fIsString[]$fIsStringCombiningCharacter$fArbitraryCombiningSequence$fIsStringCombiningSequence'$fApplyCombineCharCombiningSequenceText$fApplyCombineChar[]Text($fApplyCombineCharCombiningCharacterText$$fApplyCombineCombiningCharacter[][]$fApplyCombineCombiningCharacterCombiningSequenceCombiningSequence$fApplyCombineCombiningCharacterCombiningCharacterCombiningSequence$fEqCombiningSequence$fOrdCombiningSequence$fReadCombiningSequence$fShowCombiningSequence$fBoundedCombiningCharacter$fEnumCombiningCharacter$fEqCombiningCharacter$fOrdCombiningCharacter$fReadCombiningCharacter$fShowCombiningCharacter ChessPieceChess90 Chess45Knight ChessHybridChessHybridType KnightQueen KnightRook KnightBishopRotate45R45R135R225R315ChessPieceTypeKingQueenRookBishopKnightPawn Equihopper ChessColorWhiteBlackNeutralChessColorBinaryBWhiteBBlackPrincessCardinalEmpressMarshall Chancellor SuperqueenOmnipotentQueenTerrorAmazon Nightrider Grasshopper chessPiece$fArbitraryChessColorBinary$fArbitraryChessColor$fArbitraryChessPieceType$fArbitraryRotate45$fArbitraryChessHybridType$fArbitraryChessPiece$fEqChessPiece$fOrdChessPiece$fReadChessPiece$fShowChessPiece$fBoundedChessHybridType$fEnumChessHybridType$fEqChessHybridType$fOrdChessHybridType$fReadChessHybridType$fShowChessHybridType$fBoundedRotate45$fEnumRotate45 $fEqRotate45 $fOrdRotate45$fReadRotate45$fShowRotate45$fBoundedChessPieceType$fEnumChessPieceType$fEqChessPieceType$fOrdChessPieceType$fReadChessPieceType$fShowChessPieceType$fBoundedChessColor$fEnumChessColor$fEqChessColor$fOrdChessColor$fReadChessColor$fShowChessColor$fBoundedChessColorBinary$fEnumChessColorBinary$fEqChessColorBinary$fOrdChessColorBinary$fReadChessColorBinary$fShowChessColorBinaryCardBackJokerTrumpFoolTrump1Trump2Trump3Trump4Trump5Trump6Trump7Trump8Trump9Trump10Trump11Trump12Trump13Trump14Trump15Trump16Trump17Trump18Trump19Trump20Trump21 JokerColorRedCardRankAceR2R3R4R5R6R7R8R9R10JackCardSuitSpadesHeartsDiamondsClubs CollectiveGameWinterAutumnSummerSpring VisualArtsOpenAirShoppingDanceFireWaterAirEarthNightEvening AfternoonMorningOldAgeMaturityYouth Childhood IndividualReKönigRoiReginaKöniginDame CavaliereCavallRitterOber ChevalierFantePageUnterBubeValetWands PentaclesCupsSwordsbackcard'jokertrumpcard$fUnicodeTextCardSuit$fUnicodeCharacterCardSuit$fArbitraryCardSuit$fArbitraryCardRank$fArbitraryJokerColor$fArbitraryTrump $fBoundedCard$fArbitraryCard$fEqCard $fOrdCard $fReadCard $fShowCard$fBoundedTrump $fEnumTrump $fEqTrump $fOrdTrump $fReadTrump $fShowTrump$fBoundedJokerColor$fEnumJokerColor$fEqJokerColor$fOrdJokerColor$fReadJokerColor$fShowJokerColor$fBoundedCardRank$fEnumCardRank $fEqCardRank $fOrdCardRank$fReadCardRank$fShowCardRank$fBoundedCardSuit$fEnumCardSuit $fEqCardSuit $fOrdCardSuit$fReadCardSuit$fShowCardSuitBlockupperlowerRowleftright fromBlock fromBlock'filled$fArbitrary1Row$fArbitraryRow$fApplicativeRow$fUnicodeTextBlock$fUnicodeCharacterBlock$fArbitrary1Block$fArbitraryBlock$fApplicativeBlock$fBoundedBlock $fEqBlock$fFoldableBlock$fFunctorBlock $fOrdBlock $fReadBlock $fShowBlock$fTraversableBlock $fBoundedRow$fEqRow $fFoldableRow $fFunctorRow$fOrdRow $fReadRow $fShowRow$fTraversableRowBraillerow1row2row3row4Braille6topmiddlebottom toBraille' toBraille fromBraille' fromBraille6' fromBraille fromBraille6braille6braille$fUnicodeTextBraille6$fUnicodeCharacterBraille6$fArbitrary1Braille6$fArbitraryBraille6$fUnicodeTextBraille$fUnicodeCharacterBraille$fArbitrary1Braille$fArbitraryBraille$fBoundedBraille $fEqBraille$fFoldableBraille$fFunctorBraille $fOrdBraille $fReadBraille $fShowBraille$fTraversableBraille$fBoundedBraille6 $fEqBraille6$fFoldableBraille6$fFunctorBraille6 $fOrdBraille6$fReadBraille6$fShowBraille6$fTraversableBraille6 BallotBoxEmptyCheckCross toCheckBox toCrossBox$fUnicodeTextBallotBox$fUnicodeCharacterBallotBox$fArbitraryBallotBox$fBoundedBallotBox$fEnumBallotBox $fEqBallotBox$fOrdBallotBox$fReadBallotBox$fShowBallotBoxDieValueIIIIIIIVVVI toDieValuedie$fUnicodeTextDieValue$fUnicodeCharacterDieValue$fArbitraryDieValue$fBoundedDieValue$fEnumDieValue $fEqDieValue $fOrdDieValue$fReadDieValue$fShowDieValue ComplexDomino SimpleDominoOrientedDominoDominoleftTop rightBottom:| fromDomino' fromDominodominoHdominoH'dominoVdominoV'dominodomino'$fUnicodeTextOriented$fUnicodeTextOriented0$fUnicodeCharacterOriented$fUnicodeCharacterOriented0$fBoundedDomino$fArbitrary1Domino$fArbitraryDomino$fApplicativeDomino $fEqDomino$fFoldableDomino$fFunctorDomino $fOrdDomino $fReadDomino $fShowDomino$fTraversableDominoAA032AA031AA030AA029AA028AA027AA026AA025AA024AA023AA022AA021AA020AA019AA018AA017AA016AA015AA014AA013AA012AA011AA010AA009AA008AA007BAA007AAA007AA006AA005AA004AA003AA002AA001Z016HZ016GZ016FZ016EZ016DZ016CZ016BZ016AZ016Z015IZ015HZ015GZ015FZ015EZ015DZ015CZ015BZ015AZ015Z014Z013Z012Z011Z010Z009Z008Z007Z006Z005AZ005Z004AZ004Z003BZ003AZ003Z002DZ002CZ002BZ002AZ002Z001Y008Y007Y006Y005Y004Y003Y002Y001AY001X008AX008X007X006AX006X005X004BX004AX004X003X002X001W025W024AW024W023W022W021W020W019W018AW018W017AW017W016W015W014AW014W013W012W011W010AW010W009AW009W008W007W006W005W004W003AW003W002W001V040AV040V039V038V037AV037V036V035V034V033AV033V032V031AV031V030AV030V029AV029V028AV028V027V026V025V024V023AV023V022V021V020LV020KV020JV020IV020HV020GV020FV020EV020DV020CV020BV020AV020V019V018V017V016V015V014V013V012BV012AV012V011CV011BV011AV011V010V009V008V007BV007AV007V006V005V004V003V002AV002V001IV001HV001GV001FV001EV001DV001CV001BV001AV001U042U041U040U039U038U037U036U035U034U033U032AU032U031U030U029AU029U028U027U026U025U024U023AU023U022U021U020U019U018U017U016U015U014U013U012U011U010U009U008U007U006BU006AU006U005U004U003U002U001T036T035T034T033AT033T032AT032T031T030T029T028T027T026T025T024T023T022T021T020T019T018T017T016AT016T015T014T013T012T011AT011T010T009AT009T008AT008T007AT007T006T005T004T003AT003T002T001S046S045S044S043S042S041S040S039S038S037S036S035AS035S034S033S032S031S030S029S028S027S026BS026AS026S025S024S023S022S021S020S019S018S017AS017S016S015S014BS014AS014S013S012S011S010S009S008S007S006AS006S005S004S003S002AS002S001R029R028R027R026R025R024R023R022R021R020R019R018R017R016AR016R015R014R013R012R011R010AR010R009R008R007R006R005R004R003BR003AR003R002AR002R001Q007Q006Q005Q004Q003Q002Q001P011P010P009P008P007P006P005P004P003AP003P002P001AP001O051O050BO050AO050O049O048O047O046O045O044O043O042O041O040O039O038O037O036DO036CO036BO036AO036O035O034O033AO033O032O031O030AO030O029AO029O028O027O026O025AO025O024AO024O023O022O021O020AO020O019AO019O018O017O016O015O014O013O012O011O010CO010BO010AO010O009O008O007O006FO006EO006DO006CO006BO006AO006O005AO005O004O003O002O001AO001NU022ANU022NU021NU020NU019NU018ANU018NU017NU016NU015NU014NU013NU012NU011ANU011NU010ANU010NU009NU008NU007NU006NU005NU004NU003NU002NU001NL020NL019NL018NL017ANL017NL016NL015NL014NL013NL012NL011NL010NL009NL008NL007NL006NL005ANL005NL004NL003NL002NL001N042N041N040N039N038N037AN037N036N035AN035N034AN034N033AN033N032N031N030N029N028N027N026N025AN025N024N023N022N021N020N019N018BN018AN018N017N016N015N014N013N012N011N010N009N008N007N006N005N004N003N002N001M044M043M042M041M040AM040M039M038M037M036M035M034M033BM033AM033M032M031AM031M030M029M028AM028M027M026M025M024AM024M023M022AM022M021M020M019M018M017AM017M016AM016M015AM015M014M013M012HM012GM012FM012EM012DM012CM012BM012AM012M011M010AM010M009M008M007M006M005M004M003AM003M002M001BM001AM001L008L007L006AL006L005L004L003L002AL002L001K008K007K006K005K004K003K002K001I015I014I013I012I011AI011I010AI010I009AI009I008I007I006I005AI005I004I003I002I001H008H007H006AH006H005H004H003H002H001G054G053G052G051G050G049G048G047G046G045AG045G044G043AG043G042G041G040G039G038G037AG037G036AG036G035G034G033G032G031G030G029G028G027G026AG026G025G024G023G022G021G020AG020G019G018G017G016G015G014G013G012G011AG011G010G009G008G007BG007AG007G006AG006G005G004G003G002G001F053F052F051CF051BF051AF051F050F049F048F047AF047F046AF046F045AF045F044F043F042F041F040F039F038AF038F037AF037F036F035F034F033F032F031AF031F030F029F028F027F026F025F024F023F022F021AF021F020F019F018F017F016F015F014F013AF013F012F011F010F009F008F007F006F005F004F003F002F001AF001E038E037E036E034AE034E033E032E031E030E029E028AE028E027E026E025E024E023E022E021E020AE020E019E018E017AE017E016AE016E015E014E013E012E011E010E009AE009E008AE008E007E006E005E004E003E002E001D067HD067GD067FD067ED067DD067CD067BD067AD067D066D065D064D063D062D061D060D059D058D057D056D055D054AD054D053D052AD052D051D050ID050HD050GD050FD050ED050DD050CD050BD050AD050D049D048AD048D047D046AD046D045D044D043D042D041D040D039D038D037D036D035D034AD034D033D032D031AD031D030D029D028D027AD027D026D025D024D023D022D021D020D019D018D017D016D015D014D013D012D011D010D009D008AD008D007D006D005D004D003D002D001C024C023C022C021C020C019C018C017C016C015C014C013C012C011C010AC010C009C008C007C006C005C004C003C002CC002BC002AC002C001B009B008B007B006B005AB005B004B003B002B001A070A069A068A067A066A065A064A063A062A061A060A059A058A057A056A055A054A053A052A051A050A049A048A047A046A045AA045A044A043AA043A042AA042A041A040AA040A039A038A037A036A035A034A033A032AA032A031A030A029A028A027A026A025A024A023A022A021A020A019A018A017AA017A016A015A014AA014A013A012A011A010A009A008A007A006BA006AA006A005AA005A004A003A002A001 circledNumbercircledNumber' circledAlpha circledAlpha'parenthesizedNumberparenthesizedNumber'numberWithPeriodnumberWithPeriod'doubleCircledNumberdoubleCircledNumber'numberWithCommanumberWithComma'parenthesizedAlphaparenthesizedAlpha'squaredUppercasesquaredUppercase'whiteOnBlackCircledUppercasewhiteOnBlackCircledUppercase'whiteOnBlackSquaredUppercasewhiteOnBlackSquaredUppercase'numberWhiteOnBlackCirclenumberWhiteOnBlackCircle'regionalIndicatorUppercaseregionalIndicatorUppercase' MoonPhaseNewMoonWaxingCrescent FirstQuarter WaxingGibbousFullMoon WaningGibbous ThirdQuarterWaningCrescentZodiacAriesTaurusGeminiCancerLeoVirgoLibraScorpio Sagittarius CapricornAquariusPiscesSkinColorModifierLight MediumLightMedium MediumDarkDarkGenderFemaleMale BloodTypeOBAABClockhours minutes30SubFlagFlagFish WaterBearerSeaGoat GoatHorned MountainGoat CapricornusArcherCentaurScorpionScorpiusScalesMaidenLionCrabTwinsBullRam FitzPatrickVI FitzPatrickV FitzPatrickIVFitzPatrickIII FitzPatrickII FitzPatrickIWLSSCTENGZWZMZAYTYEXKWSWFVUVNVGVEVCVAUZUYUSUNUMUGUATZTWTVTTTRTOTNTMTLTKTJTHTGTFTDTCTASZSYSXSVSTSSSRSOSNSMSLSKSJSISHSGSESDSCSBSARWRURSROREQAPYPWPTPSPRPNPMPLPKPHPGPFPEPAOMNZNUNRNPNONLNINGNFNENCNAMZMYMXMWMVMUMTMSMRMQMPMOMNMMMLMKMHMGMFMEMDMCMALYLVLULTLSLRLKLILCLBLAKZKYKWKRKPKNKMKIKHKGKEJPJOJMJEITISIRIQIOINIMILIEIDICHUHTHRHNHMHKGYGWGUGTGSGRGQGPGNGMGLGIGHGGGFGEGDGBGAFRFOFMFKFJFIEUETESEREHEGEEECEADZDODMDKDJDGDECZCYCXCWCVCUCRCPCOCNCMCLCKCICHCGCFCDCCCABZBYBWBVBTBSBRBQBOBNBMBLBJBIBHBGBFBEBDBBBAAZAXAWAUATASARAQAOAMALAIAGAFAEADAC EmojiSuffixflagflag' flagChars closestClockclockfromFitzPatrickiso3166Alpha2ToFlag'iso3166Alpha2ToFlagvalidFlagEmoji$fUnicodeTextFlag $fEnumFlag$fArbitraryFlag $fBoundedFlag$fUnicodeTextSubFlag $fEnumSubFlag$fArbitrarySubFlag$fBoundedSubFlag$fUnicodeTextClock$fUnicodeCharacterClock$fArbitraryClock $fEnumClock$fBoundedClock$fUnicodeTextBloodType$fArbitraryBloodType$fBitsBloodType$fUnicodeTextGender$fArbitraryGender$fUnicodeTextSkinColorModifier#$fUnicodeCharacterSkinColorModifier$fArbitrarySkinColorModifier$fUnicodeTextZodiac$fUnicodeCharacterZodiac$fArbitraryZodiac$fUnicodeTextMoonPhase$fUnicodeCharacterMoonPhase$fArbitraryMoonPhase$fBoundedMoonPhase$fEnumMoonPhase $fEqMoonPhase$fOrdMoonPhase$fReadMoonPhase$fShowMoonPhase$fBoundedZodiac $fEnumZodiac $fEqZodiac $fOrdZodiac $fReadZodiac $fShowZodiac$fBoundedSkinColorModifier$fEnumSkinColorModifier$fEqSkinColorModifier$fOrdSkinColorModifier$fReadSkinColorModifier$fShowSkinColorModifier$fBoundedGender $fEnumGender $fEqGender $fOrdGender $fReadGender $fShowGender$fBoundedBloodType$fEnumBloodType $fEqBloodType$fOrdBloodType$fReadBloodType$fShowBloodType $fEqClock $fOrdClock $fShowClock $fEqSubFlag $fOrdSubFlag $fShowSubFlag$fEqFlag $fOrdFlag $fShowFlagWeightedSimpleWeightHeavyPartsupdownFrameweightedToSimplesimpleToWeighted simpleToLight simpleToHeavysimplesimple' simpleWithArcweighted fromWeighted' fromLight fromLight' fromHeavy fromHeavy' fromSimple' fromSimple fromWeighted$fApplicativeHorizontal$fArbitrary1Horizontal$fArbitraryHorizontal$fMonoidHorizontal$fSemigroupHorizontal$fApplicativeVertical$fArbitrary1Vertical$fArbitraryVertical$fMonoidVertical$fSemigroupVertical$fUnicodeTextParts$fUnicodeCharacterParts$fApplicativeParts$fArbitrary1Parts$fArbitraryParts $fMonoidParts$fSemigroupParts$fUnicodeTextParts0$fUnicodeCharacterParts0$fArbitraryWeight$fBoundedWeight $fEnumWeight $fEqWeight $fOrdWeight $fReadWeight $fShowWeight$fBoundedParts $fEqParts$fFoldableParts$fFunctorParts $fOrdParts $fReadParts $fShowParts$fTraversableParts$fBoundedVertical $fEqVertical$fFoldableVertical$fFunctorVertical $fOrdVertical$fReadVertical$fShowVertical$fTraversableVertical$fBoundedHorizontal$fEqHorizontal$fFoldableHorizontal$fFunctorHorizontal$fOrdHorizontal$fReadHorizontal$fShowHorizontal$fTraversableHorizontalfrakturRegular'frakturRegular frakturBold' frakturBoldfraktur'fraktur doubleStruck' doubleStruckintToDigitDoubleStruck'intToDigitDoubleStruckdigitDoubleStruck'digitDoubleStruck monospace' monospaceintToDigitMonospace'intToDigitMonospacedigitMonospace'digitMonospacedigitSansSerifRegular'digitSansSerifRegulardigitSansSerifBold'digitSansSerifBolddigitSansSerif'digitSansSerifintToDigitSansSerifRegular'intToDigitSansSerifRegularintToDigitSansSerifBold'intToDigitSansSerifBoldintToDigitSansSerif'intToDigitSansSerifgreekSansSerifgreekSansSerif'greekSansSerifNoBoldNoItalic'greekSansSerifNoBoldNoItalicgreekSansSerifNoBoldItalic'greekSansSerifNoBoldItalicgreekSansSerifBoldNoItalic'greekSansSerifBoldNoItalicgreekSansSerifBoldItalic'greekSansSerifBoldItalicgreekSansSerifBold'greekSansSerifBoldgreekSansSerifNoBold'greekSansSerifNoBoldgreekSansSerifItalic'greekSansSerifItalicgreekSansSerifNoItalic'greekSansSerifNoItaliclatinSansSeriflatinSansSerif'latinSansSerifNoBoldNoItalic'latinSansSerifNoBoldNoItaliclatinSansSerifNoBoldItalic'latinSansSerifNoBoldItaliclatinSansSerifBoldNoItalic'latinSansSerifBoldNoItaliclatinSansSerifBoldItalic'latinSansSerifBoldItaliclatinSansSerifBold'latinSansSerifBoldlatinSansSerifNoBold'latinSansSerifNoBoldlatinSansSerifItalic'latinSansSerifItaliclatinSansSerifNoItalic'latinSansSerifNoItalic sansSerif sansSerif'sansSerifItalic'sansSerifItalicsansSerifNoItalic'sansSerifNoItalicsansSerifBold' sansSerifBoldsansSerifNoBold'sansSerifNoBoldsansSerifNoBoldNoItalic'sansSerifNoBoldNoItalicsansSerifNoBoldItalic'sansSerifNoBoldItalicsansSerifBoldNoItalic'sansSerifBoldNoItalicsansSerifBoldItalic'sansSerifBoldItalicscriptRegular' scriptRegular scriptBold' scriptBoldscript'scriptcalligraphyRegular'calligraphyRegularcalligraphyBold'calligraphyBold calligraphy' calligraphy digitSerif' digitSerifdigitSerifRegular'digitSerifRegulardigitSerifBold'digitSerifBoldintToDigitSerifRegular'intToDigitSerifRegularintToDigitSerifBold'intToDigitSerifBoldintToDigitSerif'intToDigitSerif greekSerif greekSerif'greekSerifNoBoldNoItalic'greekSerifNoBoldNoItalicgreekSerifNoBoldItalic'greekSerifNoBoldItalicgreekSerifBoldNoItalic'greekSerifBoldNoItalicgreekSerifBoldItalic'greekSerifBoldItalicgreekSerifBold'greekSerifBoldgreekSerifNoBold'greekSerifNoBoldgreekSerifItalic'greekSerifItalicgreekSerifNoItalic'greekSerifNoItalic latinSerif latinSerif'latinSerifNoBoldNoItalic'latinSerifNoBoldNoItaliclatinSerifNoBoldItalic'latinSerifNoBoldItaliclatinSerifBoldNoItalic'latinSerifBoldNoItaliclatinSerifBoldItalic'latinSerifBoldItaliclatinSerifBold'latinSerifBoldlatinSerifNoBold'latinSerifNoBoldlatinSerifItalic'latinSerifItaliclatinSerifNoItalic'latinSerifNoItalicserifserif'serifNoItalic' serifNoItalic serifItalic' serifItalic serifBold' serifBold serifNoBold' serifNoBoldserifNoBoldNoItalic'serifNoBoldNoItalicserifNoBoldItalic'serifNoBoldItalicserifBoldNoItalic'serifBoldNoItalicserifBoldItalic'serifBoldItalicmath'math mathAlpha' mathAlpha latinMathdigit'digitintToDigitChar'intToDigitCharchar10char11duodecimalDigit'duodecimalDigitduodecimalNumberduodecimalNumber' singleStroke singleStroke1 singleStroke2 singleStroke3 singleStroke4 singleStroke5singleStroke5' singleStroke6 singleStroke7 singleStroke8 singleStroke9 cattleHobble cattleHobble1 cattleHobble2cattleHobble2' cattleHobble3cattleHobble3' cattleHobble4cattleHobble4' cattleHobble5cattleHobble5' cattleHobble6 cattleHobble7 cattleHobble8 cattleHobble9 coilOfRope coilOfRope1 coilOfRope2 coilOfRope3 coilOfRope4 coilOfRope5 coilOfRope5' coilOfRope6 coilOfRope7 coilOfRope8 coilOfRope9 waterLily waterLily1 waterLily2 waterLily3 waterLily4 waterLily5 waterLily6 waterLily7 waterLily8 waterLily9 bentFinger bentFinger1 bentFinger2 bentFinger3 bentFinger4 bentFinger5 bentFinger5' bentFinger6 bentFinger7 bentFinger8 bentFinger9tadpolehehnfrplusminusegyptianNumberegyptianNumber'egyptianNumber'' RomanLiteralVIIVIIIIXXXIXIILCDM RomanStyleAdditive Subtractive toLiterals romanLiteral romanLiteral' romanNumeral romanNumeral'romanNumeralCase romanNumber romanNumber'romanNumberCase$fDefaultRomanStyle$fArbitraryRomanStyle$fUnicodeTextRomanLiteral$fUnicodeCharacterRomanLiteral$fArbitraryRomanLiteral$fBoundedRomanLiteral$fEnumRomanLiteral$fEqRomanLiteral$fShowRomanLiteral$fReadRomanLiteral$fBoundedRomanStyle$fEnumRomanStyle$fEqRomanStyle$fShowRomanStyle$fReadRomanStylesegmentedDigit'segmentedDigit privateStart privateStop isPrivateCharprivateCharGenKlingonChEGhHJNNgPQQUpperRSTTlhUWY GlottalStopZeroOneTwoThreeFourFiveSixSevenEightNineCommaFullStop Mummification$fUnicodeTextKlingon$fUnicodeCharacterKlingon$fArbitraryKlingon$fBoundedKlingon $fEnumKlingon $fEqKlingon $fOrdKlingon $fReadKlingon $fShowKlingontoSuptoSubratioToUnicoderatioToUnicode'asSupasSup' asSupPlusasSubasSub' asSubPlusghc-prim GHC.TypesCharcontainers-0.6.2.1Data.Map.InternalMap GHC.MaybeJustNothingTrueFalse text-1.2.3.2Data.Text.InternalText1data-default-class-0.1.2.0-IIN1s3V8yfYEDHe5yjxXHVData.Default.ClassdefDefaultGHC.EnumEnumfromEnumminBoundmaxBoundGHC.RealIntegralBoolMaybe_dispatchLatinGreekDigit'_dispatchLatinGreekDigit_shiftC_ordc_baseUpperLower_baseUpperLowerNum _isValidInt_withCondition(QuickCheck-2.13.2-FmeR26uNkz2IUtJuxc5iIQTest.QuickCheck.GenGenRatio