нУЁh$=rДу !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗ Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■ ∙ √!≈!≤!≥! "⌡"°"²"·"÷"═"║"╒"ё"є"╔"і"ї"╗"╘"╙"╚"╛"ґ"ў"╞"╟"╠"╡"Ё"Є"╣"І"Ї"╦"╧"╨"╩"╪"Ґ"Ў"©"ю"а"б"ц"д"е"ф"г"х"и"й"к#л#м#н#о#п#я#р#с#т#%,Determine and manipulate bracket characters.hapytexeu+gh@gmail.comexperimentalPOSIXSafeU<unicode-tricks(A data type that is used to specify the type of bracket.unicode-tricks(The bracket is used to "open" a context.unicode-tricks)The bracket is used to "close" a context. unicode-tricksЭA list of 2-tuples where the first item of each tuple is the opening bracket, and the second item its closing counterpart. unicode-tricks$The list of all brackets characters.unicode-tricks A list of у%s that contains all opening brackets.unicode-tricks A list of у%s that contains all closing brackets. unicode-tricksA ж that maps the given open bracket" characters to the corresponding close bracket.unicode-tricksA ж that maps the given close bracket" characters to the corresponding open bracket.unicode-tricksCheck if the given у is a bracket character.unicode-tricksCheck if the given у is an open bracket.unicode-tricksCheck if the given у is a close bracket.unicode-tricks Check the of the у wrapped in a в data construct; ь if the given у is not a bracket character.unicode-tricks Check the of the у. For a у that is not a bracket the behavior is unspecified.unicode-tricks&Get the bracket character that is the counterpart of the given bracket character wrapped in a в! data constructor. If the given у is not a bracket, ь is returned.unicode-tricks&Get the bracket character that is the counterpart of the given bracket character. If the given у is not a bracket, the given у is returned. unicode-tricksThe list of all уs that are brackets.unicode-tricksThe list of all уs that are opening brackets.unicode-tricksThe list of all уs that are closing brackets.unicode-tricks The given у to test.unicode-tricksы if the given у is an open bracket; з otherwise.unicode-tricks The given у to test.unicode-tricksы if the у is an open bracket; з otherwise.unicode-tricks The given у to test.unicode-tricksы if the у is an close bracket; з otherwise.unicode-tricks The given у5 for which we want to determine the opposite bracket.unicode-tricks"The opposite bracket wrapped in a в if the given у is a bracket character; ь otherwise.unicode-tricks The given у5 for which we want to determine the opposite bracket.unicode-tricks"The opposite bracket if the given у is a bracket; otherwise the given у. Visualizing control characters.hapytexeu+gh@gmail.comexperimentalPOSIXSafea*unicode-tricksCheck if the given у+ is a control character in the ASCII range.unicode-tricksCheck if for the given у there is a visualization.unicode-tricks Another symbol used to denote a space that works with ╒H. The $ function uses ═H. unicode-tricks Another symbol used to denote a space that works with ёH. The $ function uses ═H.!unicode-tricks Another symbol used to denote a new line that works with єH$. The control picture function uses ┼H."unicode-tricks Another symbol used to denote a delete character that works with ╔H$. The control picture function uses ║H.#unicode-tricks Another symbol used to denote a substitute character that works with іH$. The control picture function uses H.$unicode-tricksConvert the given control у to a у░ that visualizes that characters. This is sometimes done by diagonal lettering of the characters denoting the control character. If the given у is not a control character, ь is returned.%unicode-tricksConvert the given control у to a у/ that visualizes that character. If the given у< is not a control character, it is unspecified what happens.&unicode-tricks-Convert the given visualization of a control у to that control у wrapped in a в. If the given у1 is not a visualization of a control character, ь is returned.'unicode-tricks-Convert the given visualization of a control у to that control у. If the given уп is not a visualization of a control character, it is unspecified what happens.unicode-tricks The given у to check.unicode-tricksы if the given у6 is a control character in the ASCII range; otherwise з.unicode-tricks The given у to check.unicode-tricksы3 if the given control character can be visualized; з otherwise.unicode-tricksAnother character for space. unicode-tricksAnother character for space.!unicode-tricksAnother character for a new line."unicode-tricksAnother character for delete.#unicode-tricksAnother character for substitute.$unicode-tricksThe given control у to convert.%unicode-tricksThe given control у.unicode-tricksThe corresponding у that visualizes the control у.&unicode-tricks The given visualization of control у.unicode-tricksThe corresponding control у wrapped in a во if the given character is the visualization of a control character; otherwise ь.'unicode-tricks The given visualization of control у.unicode-tricksThe corresponding control у. !"#$%&'$%&' !"#юA module that defines data structures used in the other modules.hapytexeu+gh@gmail.comexperimentalPOSIXSafe-5679>юы╗Тк(unicode-tricksаA class from which boejcts can be derived that map to and from a sequence of unicode characters.)unicode-tricksConvert the given object to a ш object.*unicode-tricksConvert the given ш to an object wrapped in a в# data constructor if that exists; ь otherwise.+unicode-tricksConvert the given ш to an object. If the ш. does not map on an element, the behavior is unspecified), it can for example result in an error.,unicode-tricksаA class from which objects can be derived that map to and from a single unicode character.-unicode-tricks&Convert the given object to a Unicode уacter..unicode-tricksConvert the given у acter to an object wrapped in a в# data constructor if that exists; ь otherwise./unicode-tricksConvert the given уacter to an object. If the у3acter does not map on an element, the behavior is unspecified), it can for example result in an error.0unicode-tricksAn alias of the , type class.1unicode-tricks╛Specify if one should ligate, or not. When litigation is done characters that are normally written in two (or more) characters are combined in one character. For example БB instead of ЮBЮBЮB.2unicode-tricks7A ligate operation is performed on the characters, the э for 't:Ligate'.3unicode-tricks2No ligate operation is performed on the charaters.4unicode-tricks/A data type that specifies if the font is with serifs or not. The 'Defaul;t' is 6.5unicode-tricks&The character is a character rendered without serifs.6unicode-tricks&The character is a character rendered with serifs.7unicode-tricks.A data type that can be used to specify if an italic character is used. The щ is 8.8unicode-tricksNo italic characters are used.9unicode-tricksItalic characters are used.:unicode-tricksдA data type that lists the possible emphasis of a font. This can be < or ; the щ is ;.;unicode-tricks.The characters are not stressed with boldface.<unicode-tricks(The characters are stressed in boldface.=unicode-tricksбA data type that specifies that an item has been given a rotation.?unicode-tricksThe object that is rotated.@unicode-tricks#The rotation of the rotated object.Aunicode-tricksМPossible rotations of a unicode character if that character can be rotated over 0, 90, 180, and 270 degrees.Bunicode-tricksNo rotation.Cunicode-tricksRotation over 90 degrees.Dunicode-tricksRotation over 180 degrees.Eunicode-tricksRotation over 270 degrees.Funicode-tricksфA data type that specifies that an item has been given an orientation.Hunicode-tricksThe object that is oriented.Iunicode-tricks$The oriented of the oriented object.Junicode-tricksюThe possible orientations of a unicode character, these can be horizontal, or vertical.Kunicode-tricks Horizontal orientation.Lunicode-tricksVertical orientation.Municode-tricks+Specify whether we write a positive number with or without a plus sign. the щ is N.Nunicode-tricksWrite positive numbers without using a plus sign.Ounicode-tricksWrite positive numbers with a plus sign.Punicode-tricks$Specify whether we write a value in Q or R. The щ is Q9, since for example often Roman numerals are written in upper case.Qunicode-tricksThe upper case formatting.Runicode-tricksThe lower case formatting.Sunicode-tricks(Pick one of the two values based on the P value.Tunicode-tricks0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz satisfy this predicate.]unicode-tricks Checks if a charcter is a basic greek alphabetic3 character or a Greek-like symbol. The characters :▒▓⌠■∙√≈≤≥ ⌡°²·÷═║ёє╔ії╗╘┤DТ╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхи┌DУяПуЯж satisfy this predicate.^unicode-tricks,Calculate for a given plus and minus sign a ш+ object for the given number in the given M._unicode-tricks5A function to make it more convenient to implement a sign-value system. This is done for a given radixа a function that maps the given value and the given weight to a ш object, a ш object for zeroю (since in some systems that is different), and characters for plus and minus&. The function then will for a given Mи convert the number to a sequence of characters with respect to how the sign-value system is implemented.`unicode-tricksоA function to make it more convenient to implement a /positional number system. This is done for a given :radix/ a given conversion funtion that maps a value to a у, and a у for plus and minus!. The function then construct a ш object for a given M and a given number.aunicode-tricksоA function to make it more convenient to implement a /positional number system with radix/ 10.bunicode-tricks&Check if the given character is not a reserved character5. This is denoted in the Unicode documentation with .cunicode-tricks"Check if the given character is a reserved character5. This is denoted in the Unicode documentation with .dunicode-tricks╘Check if the given character is a character according to the Unicode specifications. Codepoints that are not a character are denoted in the Unicode documentation with .eunicode-tricks┤Check if the given character is not a character according to the Unicode specifications. The Unicode documentation denotes these with .funicode-tricksMap the given у9 object to an object with a type that is an instance of ч with a given offset for the уacter range.gunicode-tricksMap the given у9 object to an object with a type that is an instance of ча. It first checks if the mapping results in a value between the ъ values for Ю and А.hunicode-tricks8Map the given object with a type that is an instance of ч to a у"acter with a given offset for the уacter value.iunicode-tricksэConstruct a function that maps digits to the character with the given value for the offset.junicode-tricksэConstruct a function that maps digits to the character with the given value for the offset.kunicode-tricksяConstruct a function that maps digits to the character with the given value for 0.lunicode-tricksнConstruct a function that maps digits to characters with the given value for 0.municode-tricksяConstruct a function that maps digits to the character with the given value for 0.nunicode-tricksнConstruct a function that maps digits to characters with the given value for 0.ounicode-tricksзConstruct a function that maps upper case alphabetic characters with the given value for A.punicode-tricksзConstruct a function that maps upper case alphabetic characters with the given value for A.qunicode-tricksзConstruct a function that maps lower case alphabetic characters with the given value for a.runicode-tricksзConstruct a function that maps lower case alphabetic characters with the given value for a.sunicode-tricksшConstruct a function that maps lower case alphabetic characters with the given values for A and a.tunicode-tricksшConstruct a function that maps lower case alphabetic characters with the given values for A and a.#)unicode-tricks!The given object to convert to a ш object.unicode-tricksA ш: object that is the Unicode representation of the element.*unicode-tricks The given ш to convert to an object.unicode-tricks#The equivalent object wrapped in a в data constructor if it exists; ь otherwise.+unicode-tricks The given ш to convert to an object.unicode-tricksшThe given equivalent object. If there is no equivalent object, the behavior is unspecified.-unicode-tricks!The given object to convert to a уacter.unicode-tricksThe equivalent Unicode уacter..unicode-tricks The given уacter to convert to an element.unicode-tricksAn element if the given у&acter maps to an element wrapped in a в; ь otherwise./unicode-tricks The given уacter to convert to an element.unicode-tricks2The given element that is equivalent to the given уacter.Sunicode-tricksThe value to return in case of Q.unicode-tricksThe value to return in case of R.unicode-tricks The given letter case.unicode-tricks.One of the two given values, depending on the P value.Tunicode-tricksThe value to return in case of N.unicode-tricksThe value to return in case of O.unicode-tricksThe plus style.unicode-tricks>One of the two given values, based on the 't:PlusStyle' value.Uunicode-tricksThe value to return in case of ;.unicode-tricksThe value to return in case of <.unicode-tricksThe emphasis type.unicode-tricks=One of the two given values, based on the 't:Emphasis' value.Vunicode-tricksThe value to return in case of 8.unicode-tricksThe value to return in case of 9.unicode-tricksThe italic type.unicode-tricks?One of the two given values, based on the 't:ItalicType' value.Wunicode-tricksThe value to return in case of 5.unicode-tricksThe value to return in case of 6.unicode-tricksThe font style.unicode-tricks>One of the two given values, based on the 't:FontStyle' value.Xunicode-tricks*The value to return in case of 'v:Ligate'.unicode-tricksThe value to return in case of 3.unicode-tricksThe ligation style.unicode-tricks;One of the two given values, based on the 't:Ligate' value.^unicode-tricks=The function that maps the absolute value of the number to a ш% object that is appended to the sign.unicode-tricksThe plus sign to use.unicode-tricksThe minus sign to use.unicode-tricks The given M to use.unicode-tricks The given Б number to render.unicode-tricksA шс object that represents the given number, with the given sign numbers in the given M._unicode-tricks The given radix to use.unicode-tricksA function that maps the value and the weight to a ш object.unicode-tricks The given ш used to represent zero.unicode-tricks The given у used to denote plus.unicode-tricks The given у used to denote minus.unicode-tricks The given M to use.unicode-tricksThe given number to convert.unicode-tricksA ш5 object that denotes the given number with the given sign-value system.`unicode-tricksThe given radix to use.unicode-tricks$A function that maps the value of a digit to the corresponding у.unicode-tricks#The given character used to denote plus.unicode-tricks#The given character used to denote minus.unicode-tricks The given M to use.unicode-tricksThe given number to convert.unicode-tricksA ш5 object that denotes the given number with the given positional number system.aunicode-tricks$A function that maps the value of a digit to the corresponding у.unicode-tricks#The given character used to denote plus.unicode-tricks#The given character used to denote minus.unicode-tricks The given M to use.unicode-tricksThe given number to convert.unicode-tricksA ш5 object that denotes the given number with the given positional number system.bunicode-tricks The given уacter to check.unicode-tricksы if the given уacter is not reserved; з otherwise.cunicode-tricks The given уacter to check.unicode-tricksы if the given уacter is reserved; з otherwise.dunicode-tricks The given уacter to check.unicode-tricksы if the given уюacter is a character (according to the Unicode specifications); з otherwise.eunicode-tricks The given уacter to check.unicode-tricksы if the given удacter is not a character (according to the Unicode specifications); з otherwise.funicode-tricks The given offset value.unicode-tricksThe уacter to map to an ч object.unicode-tricks The given ч object for the given у.gunicode-tricks The given offset value.unicode-tricks The given уacter to map to an ч object.unicode-tricks The given ч object for the given уacter wrapped in a в if that exists; ь otherwise.hunicode-tricks The given offset value.unicode-tricks The given ч value to convert to a уacter.unicode-tricks,The character that corresponds to the given ч object.iunicode-tricksThe given offset value.unicode-tricks%The maximum value that can be mapped.unicode-tricks,The given Unicode value used for the offset.unicode-tricksхThe given number to convert, must be between the offset and the maximum.unicode-tricksThe corresponding уacter wrapped in a в6 if the number is between the offset and the maximum; ь otherwise.junicode-tricksThe given offset value.unicode-tricks,The given Unicode value used for the offset.unicode-tricks/The given number to convert to a corresponding уacter.unicode-tricksThe corresponding у%acter for the given mapping function.kunicode-tricks%The maximum value that can be mapped.unicode-tricks!The given Unicode value used for 0.unicode-tricksаThe given digit to convert to a number between 0 and the maximum.unicode-tricksThe corresponding уacter wrapped in a в if the number is between 0 and 9; ь otherwise.lunicode-tricks"The given Unicode value used for 0.unicode-tricksThe given digit to convert.unicode-tricksThe corresponding уacter, for numbers outside the 0-9" range, the result is unspecified.municode-tricks!The given Unicode value used for 0.unicode-tricks7The given digit to convert to a number between 0 and 9.unicode-tricksThe corresponding уacter wrapped in a в if the number is between 0 and 9; ь otherwise.nunicode-tricks"The given Unicode value used for 0.unicode-tricks,The given digit to convert, must be between 0 and 9.unicode-tricksThe corresponding уacter, for numbers outside the 0-9" range, the result is unspecified.ounicode-tricksThe given Unicode value for A.unicode-tricksThe given character to convert.unicode-tricks)The corresponding character wrapped in a в" if the given character is in the A-Z range; ь otherwise.punicode-tricksThe given Unicode value for A.unicode-tricks1The given upper case alphabetic value to convert.unicode-tricks?The corresponding character, if the given value is outside the A-Z" range, the result is unspecified.qunicode-tricksThe given Unicode value for a.unicode-tricksThe given character to convert.unicode-tricks)The corresponding character wrapped in a в" if the given character is in the a-z range; ь otherwise.runicode-tricksThe given Unicode value for a.unicode-tricks1The given upper case alphabetic value to convert.unicode-tricks?The corresponding character, if the given value is outside the a-z" range, the result is unspecified.sunicode-tricksThe given Unicode value for A.unicode-tricksThe given Unicode value for a.unicode-tricksThe given character to convert.unicode-tricks)The corresponding character wrapped in a в" if the given character is in the A-Z,a-z range; ь otherwise.tunicode-tricksThe given Unicode value for A.unicode-tricksThe given Unicode value for a.unicode-tricksThe given character to convert.unicode-tricks=The corresponding character if the given character is in the A-Z,a-z range; unspecified otherwise.р()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstрJKLABCDEFGHI=>?@PQRS123XYZ:;юабдХp3│ кunicode-tricksA typeclass used to apply a я or a н to a у, and return a ш object.лunicode-tricksApplies the given я or ня to the given character. The operator is right-to-left, to allow "stacking" of яs for example:5'a' *^ CombiningGraveAccent *^ CombiningPlusSignBelowмunicode-tricksApplies the given я or н▀ to the given character, and use composition characters in case that is possible. The operator is right-to-left, to allow "stacking" of яs for example:7'a' *^! CombiningGraveAccent *^! CombiningPlusSignBelowнunicode-tricks A set of я;s that can then all be applied to the same character. The л* is used both to "stack" characters in a н, and to apply a я or a н to a у.пunicode-tricks$A type synonym to make working with я more convenient.яunicode-tricks┘The list of possible combining characters. In the documentation of the combining characters, the characters are demonstrated on the bullet symbol (╒@).рunicode-tricksThe combining character COMBINING GRAVE ACCENT' from the Unicode standard, defined by '\x0300' (╒@─).сunicode-tricksThe combining character COMBINING ACUTE ACCENT' from the Unicode standard, defined by '\x0301' (╒@│).тunicode-tricksThe combining character COMBINING CIRCUMFLEX ACCENT' from the Unicode standard, defined by '\x0302' (╒@┌).уunicode-tricksThe combining character COMBINING TILDE' from the Unicode standard, defined by '\x0303' (╒@┐).жunicode-tricksThe combining character COMBINING MACRON' from the Unicode standard, defined by '\x0304' (╒@└).вunicode-tricksThe combining character COMBINING OVERLINE' from the Unicode standard, defined by '\x0305' (╒@┘).ьunicode-tricksThe combining character COMBINING BREVE' from the Unicode standard, defined by '\x0306' (╒@├).ыunicode-tricksThe combining character COMBINING DOT ABOVE' from the Unicode standard, defined by '\x0307' (╒@┤).зunicode-tricksThe combining character COMBINING DIAERESIS' from the Unicode standard, defined by '\x0308' (╒@┬).шunicode-tricksThe combining character COMBINING HOOK ABOVE' from the Unicode standard, defined by '\x0309' (╒@┴).эunicode-tricksThe combining character COMBINING RING ABOVE' from the Unicode standard, defined by '\x030a' (╒@┼).щunicode-tricksThe combining character COMBINING DOUBLE ACUTE ACCENT' from the Unicode standard, defined by '\x030b' (╒@▀).чunicode-tricksThe combining character COMBINING CARON' from the Unicode standard, defined by '\x030c' (╒@▄).ъunicode-tricksThe combining character COMBINING VERTICAL LINE ABOVE' from the Unicode standard, defined by '\x030d' (╒@█).Юunicode-tricksThe combining character $COMBINING DOUBLE VERTICAL LINE ABOVE' from the Unicode standard, defined by '\x030e' (╒@▌).Аunicode-tricksThe combining character COMBINING DOUBLE GRAVE ACCENT' from the Unicode standard, defined by '\x030f' (╒@▐).Бunicode-tricksThe combining character COMBINING CANDRABINDU' from the Unicode standard, defined by '\x0310' (╒@░).Цunicode-tricksThe combining character COMBINING INVERTED BREVE' from the Unicode standard, defined by '\x0311' (╒@▒).Дunicode-tricksThe combining character COMBINING TURNED COMMA ABOVE' from the Unicode standard, defined by '\x0312' (╒@▓).Еunicode-tricksThe combining character COMBINING COMMA ABOVE' from the Unicode standard, defined by '\x0313' (╒@⌠).Фunicode-tricksThe combining character COMBINING REVERSED COMMA ABOVE' from the Unicode standard, defined by '\x0314' (╒@■).Гunicode-tricksThe combining character COMBINING COMMA ABOVE RIGHT' from the Unicode standard, defined by '\x0315' (╒@∙).Хunicode-tricksThe combining character COMBINING GRAVE ACCENT BELOW' from the Unicode standard, defined by '\x0316' (╒@√).Иunicode-tricksThe combining character COMBINING ACUTE ACCENT BELOW' from the Unicode standard, defined by '\x0317' (╒@≈).Йunicode-tricksThe combining character COMBINING LEFT TACK BELOW' from the Unicode standard, defined by '\x0318' (╒@≤).Кunicode-tricksThe combining character COMBINING RIGHT TACK BELOW' from the Unicode standard, defined by '\x0319' (╒@≥).Лunicode-tricksThe combining character COMBINING LEFT ANGLE ABOVE' from the Unicode standard, defined by '\x031a' (╒@ ).Мunicode-tricksThe combining character COMBINING HORN' from the Unicode standard, defined by '\x031b' (╒@⌡).Нunicode-tricksThe combining character COMBINING LEFT HALF RING BELOW' from the Unicode standard, defined by '\x031c' (╒@°).Оunicode-tricksThe combining character COMBINING UP TACK BELOW' from the Unicode standard, defined by '\x031d' (╒@²).Пunicode-tricksThe combining character COMBINING DOWN TACK BELOW' from the Unicode standard, defined by '\x031e' (╒@·).Яunicode-tricksThe combining character COMBINING PLUS SIGN BELOW' from the Unicode standard, defined by '\x031f' (╒@÷).Рunicode-tricksThe combining character COMBINING MINUS SIGN BELOW' from the Unicode standard, defined by '\x0320' (╒@═).Сunicode-tricksThe combining character COMBINING PALATALIZED HOOK BELOW' from the Unicode standard, defined by '\x0321' (╒@║).Тunicode-tricksThe combining character COMBINING RETROFLEX HOOK BELOW' from the Unicode standard, defined by '\x0322' (╒@╒).Уunicode-tricksThe combining character COMBINING DOT BELOW' from the Unicode standard, defined by '\x0323' (╒@ё).Жunicode-tricksThe combining character COMBINING DIAERESIS BELOW' from the Unicode standard, defined by '\x0324' (╒@є).Вunicode-tricksThe combining character COMBINING RING BELOW' from the Unicode standard, defined by '\x0325' (╒@╔).Ьunicode-tricksThe combining character COMBINING COMMA BELOW' from the Unicode standard, defined by '\x0326' (╒@і).Ыunicode-tricksThe combining character COMBINING CEDILLA' from the Unicode standard, defined by '\x0327' (╒@ї).Зunicode-tricksThe combining character COMBINING OGONEK' from the Unicode standard, defined by '\x0328' (╒@╗).Шunicode-tricksThe combining character COMBINING VERTICAL LINE BELOW' from the Unicode standard, defined by '\x0329' (╒@╘).Эunicode-tricksThe combining character COMBINING BRIDGE BELOW' from the Unicode standard, defined by '\x032a' (╒@╙).Щunicode-tricksThe combining character $COMBINING INVERTED DOUBLE ARCH BELOW' from the Unicode standard, defined by '\x032b' (╒@╚).Чunicode-tricksThe combining character COMBINING CARON BELOW' from the Unicode standard, defined by '\x032c' (╒@╛).Ъunicode-tricksThe combining character !COMBINING CIRCUMFLEX ACCENT BELOW' from the Unicode standard, defined by '\x032d' (╒@ґ).─unicode-tricksThe combining character COMBINING BREVE BELOW' from the Unicode standard, defined by '\x032e' (╒@ў).│unicode-tricksThe combining character COMBINING INVERTED BREVE BELOW' from the Unicode standard, defined by '\x032f' (╒@╞).┌unicode-tricksThe combining character COMBINING TILDE BELOW' from the Unicode standard, defined by '\x0330' (╒@╟).┐unicode-tricksThe combining character COMBINING MACRON BELOW' from the Unicode standard, defined by '\x0331' (╒@╠).└unicode-tricksThe combining character COMBINING LOW LINE' from the Unicode standard, defined by '\x0332' (╒@╡).┘unicode-tricksThe combining character COMBINING DOUBLE LOW LINE' from the Unicode standard, defined by '\x0333' (╒@Ё).├unicode-tricksThe combining character COMBINING TILDE OVERLAY' from the Unicode standard, defined by '\x0334' (╒@Є).┤unicode-tricksThe combining character COMBINING SHORT STROKE OVERLAY' from the Unicode standard, defined by '\x0335' (╒@╣).┬unicode-tricksThe combining character COMBINING LONG STROKE OVERLAY' from the Unicode standard, defined by '\x0336' (╒@І).┴unicode-tricksThe combining character COMBINING SHORT SOLIDUS OVERLAY' from the Unicode standard, defined by '\x0337' (╒@Ї).┼unicode-tricksThe combining character COMBINING LONG SOLIDUS OVERLAY' from the Unicode standard, defined by '\x0338' (╒@╦).▀unicode-tricksThe combining character COMBINING RIGHT HALF RING BELOW' from the Unicode standard, defined by '\x0339' (╒@╧).▄unicode-tricksThe combining character COMBINING INVERTED BRIDGE BELOW' from the Unicode standard, defined by '\x033a' (╒@╨).█unicode-tricksThe combining character COMBINING SQUARE BELOW' from the Unicode standard, defined by '\x033b' (╒@╩).▌unicode-tricksThe combining character COMBINING SEAGULL BELOW' from the Unicode standard, defined by '\x033c' (╒@╪).▐unicode-tricksThe combining character COMBINING X ABOVE' from the Unicode standard, defined by '\x033d' (╒@Ґ).░unicode-tricksThe combining character COMBINING VERTICAL TILDE' from the Unicode standard, defined by '\x033e' (╒@Ў).▒unicode-tricksThe combining character COMBINING DOUBLE OVERLINE' from the Unicode standard, defined by '\x033f' (╒@©).▓unicode-tricksThe combining character COMBINING GRAVE TONE MARK' from the Unicode standard, defined by '\x0340' (╒@ю).⌠unicode-tricksThe combining character COMBINING ACUTE TONE MARK' from the Unicode standard, defined by '\x0341' (╒@а).■unicode-tricksThe combining character COMBINING GREEK PERISPOMENI' from the Unicode standard, defined by '\x0342' (╒@б).∙unicode-tricksThe combining character COMBINING GREEK KORONIS' from the Unicode standard, defined by '\x0343' (╒@ц).√unicode-tricksThe combining character COMBINING GREEK DIALYTIKA TONOS' from the Unicode standard, defined by '\x0344' (╒@д).≈unicode-tricksThe combining character COMBINING GREEK YPOGEGRAMMENI' from the Unicode standard, defined by '\x0345' (╒@е).≤unicode-tricksThe combining character COMBINING BRIDGE ABOVE' from the Unicode standard, defined by '\x0346' (╒@ф).≥unicode-tricksThe combining character COMBINING EQUALS SIGN BELOW' from the Unicode standard, defined by '\x0347' (╒@г). unicode-tricksThe combining character $COMBINING DOUBLE VERTICAL LINE BELOW' from the Unicode standard, defined by '\x0348' (╒@х).⌡unicode-tricksThe combining character COMBINING LEFT ANGLE BELOW' from the Unicode standard, defined by '\x0349' (╒@и).°unicode-tricksThe combining character COMBINING NOT TILDE ABOVE' from the Unicode standard, defined by '\x034a' (╒@й).²unicode-tricksThe combining character COMBINING HOMOTHETIC ABOVE' from the Unicode standard, defined by '\x034b' (╒@к).·unicode-tricksThe combining character COMBINING ALMOST EQUAL TO ABOVE' from the Unicode standard, defined by '\x034c' (╒@л).÷unicode-tricksThe combining character COMBINING LEFT RIGHT ARROW BELOW' from the Unicode standard, defined by '\x034d' (╒@м).═unicode-tricksThe combining character COMBINING UPWARDS ARROW BELOW' from the Unicode standard, defined by '\x034e' (╒@н).║unicode-tricksThe combining character COMBINING RIGHT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x0350' (╒@п).╒unicode-tricksThe combining character COMBINING LEFT HALF RING ABOVE' from the Unicode standard, defined by '\x0351' (╒@я).ёunicode-tricksThe combining character COMBINING FERMATA' from the Unicode standard, defined by '\x0352' (╒@р).єunicode-tricksThe combining character COMBINING X BELOW' from the Unicode standard, defined by '\x0353' (╒@с).╔unicode-tricksThe combining character COMBINING LEFT ARROWHEAD BELOW' from the Unicode standard, defined by '\x0354' (╒@т).іunicode-tricksThe combining character COMBINING RIGHT ARROWHEAD BELOW' from the Unicode standard, defined by '\x0355' (╒@у).їunicode-tricksThe combining character 0COMBINING RIGHT ARROWHEAD AND UP ARROWHEAD BELOW' from the Unicode standard, defined by '\x0356' (╒@ж).╗unicode-tricksThe combining character COMBINING RIGHT HALF RING ABOVE' from the Unicode standard, defined by '\x0357' (╒@в).╘unicode-tricksThe combining character COMBINING DOT ABOVE RIGHT' from the Unicode standard, defined by '\x0358' (╒@ь).╙unicode-tricksThe combining character COMBINING ASTERISK BELOW' from the Unicode standard, defined by '\x0359' (╒@ы).╚unicode-tricksThe combining character COMBINING DOUBLE RING BELOW' from the Unicode standard, defined by '\x035a' (╒@з).╛unicode-tricksThe combining character COMBINING ZIGZAG ABOVE' from the Unicode standard, defined by '\x035b' (╒@ш).ґunicode-tricksThe combining character COMBINING DOUBLE BREVE BELOW' from the Unicode standard, defined by '\x035c' (╒@э).ўunicode-tricksThe combining character COMBINING DOUBLE BREVE' from the Unicode standard, defined by '\x035d' (╒@щ).╞unicode-tricksThe combining character COMBINING DOUBLE MACRON' from the Unicode standard, defined by '\x035e' (╒@ч).╟unicode-tricksThe combining character COMBINING DOUBLE MACRON BELOW' from the Unicode standard, defined by '\x035f' (╒@ъ).╠unicode-tricksThe combining character COMBINING DOUBLE TILDE' from the Unicode standard, defined by '\x0360' (╒@Ю).╡unicode-tricksThe combining character COMBINING DOUBLE INVERTED BREVE' from the Unicode standard, defined by '\x0361' (╒@А).Ёunicode-tricksThe combining character 'COMBINING DOUBLE RIGHTWARDS ARROW BELOW' from the Unicode standard, defined by '\x0362' (╒@Б).Єunicode-tricksThe combining character COMBINING LATIN SMALL LETTER A' from the Unicode standard, defined by '\x0363' (╒@Ц).╣unicode-tricksThe combining character COMBINING LATIN SMALL LETTER E' from the Unicode standard, defined by '\x0364' (╒@Д).Іunicode-tricksThe combining character COMBINING LATIN SMALL LETTER I' from the Unicode standard, defined by '\x0365' (╒@Е).Їunicode-tricksThe combining character COMBINING LATIN SMALL LETTER O' from the Unicode standard, defined by '\x0366' (╒@Ф).╦unicode-tricksThe combining character COMBINING LATIN SMALL LETTER U' from the Unicode standard, defined by '\x0367' (╒@Г).╧unicode-tricksThe combining character COMBINING LATIN SMALL LETTER C' from the Unicode standard, defined by '\x0368' (╒@Х).╨unicode-tricksThe combining character COMBINING LATIN SMALL LETTER D' from the Unicode standard, defined by '\x0369' (╒@И).╩unicode-tricksThe combining character COMBINING LATIN SMALL LETTER H' from the Unicode standard, defined by '\x036a' (╒@Й).╪unicode-tricksThe combining character COMBINING LATIN SMALL LETTER M' from the Unicode standard, defined by '\x036b' (╒@К).Ґunicode-tricksThe combining character COMBINING LATIN SMALL LETTER R' from the Unicode standard, defined by '\x036c' (╒@Л).Ўunicode-tricksThe combining character COMBINING LATIN SMALL LETTER T' from the Unicode standard, defined by '\x036d' (╒@М).©unicode-tricksThe combining character COMBINING LATIN SMALL LETTER V' from the Unicode standard, defined by '\x036e' (╒@Н).юunicode-tricksThe combining character COMBINING LATIN SMALL LETTER X' from the Unicode standard, defined by '\x036f' (╒@О).аunicode-tricksThe combining character COMBINING CYRILLIC TITLO' from the Unicode standard, defined by '\x0483' (╒@┐ ).бunicode-tricksThe combining character !COMBINING CYRILLIC PALATALIZATION' from the Unicode standard, defined by '\x0484' (╒@└ ).цunicode-tricksThe combining character !COMBINING CYRILLIC DASIA PNEUMATA' from the Unicode standard, defined by '\x0485' (╒@┘ ).дunicode-tricksThe combining character !COMBINING CYRILLIC PSILI PNEUMATA' from the Unicode standard, defined by '\x0486' (╒@├ ).еunicode-tricksThe combining character COMBINING CYRILLIC POKRYTIE' from the Unicode standard, defined by '\x0487' (╒@┤ ).фunicode-tricksThe combining character HEBREW ACCENT ETNAHTA' from the Unicode standard, defined by '\x0591' (╒@▒).гunicode-tricksThe combining character HEBREW ACCENT SEGOL' from the Unicode standard, defined by '\x0592' (╒@▓).хunicode-tricksThe combining character HEBREW ACCENT SHALSHELET' from the Unicode standard, defined by '\x0593' (╒@⌠).иunicode-tricksThe combining character HEBREW ACCENT ZAQEF QATAN' from the Unicode standard, defined by '\x0594' (╒@■).йunicode-tricksThe combining character HEBREW ACCENT ZAQEF GADOL' from the Unicode standard, defined by '\x0595' (╒@∙).кunicode-tricksThe combining character HEBREW ACCENT TIPEHA' from the Unicode standard, defined by '\x0596' (╒@√).лunicode-tricksThe combining character HEBREW ACCENT REVIA' from the Unicode standard, defined by '\x0597' (╒@≈).мunicode-tricksThe combining character HEBREW ACCENT ZARQA' from the Unicode standard, defined by '\x0598' (╒@≤).нunicode-tricksThe combining character HEBREW ACCENT PASHTA' from the Unicode standard, defined by '\x0599' (╒@≥).оunicode-tricksThe combining character HEBREW ACCENT YETIV' from the Unicode standard, defined by '\x059a' (╒@ ).пunicode-tricksThe combining character HEBREW ACCENT TEVIR' from the Unicode standard, defined by '\x059b' (╒@⌡).яunicode-tricksThe combining character HEBREW ACCENT GERESH' from the Unicode standard, defined by '\x059c' (╒@°).рunicode-tricksThe combining character HEBREW ACCENT GERESH MUQDAM' from the Unicode standard, defined by '\x059d' (╒@²).сunicode-tricksThe combining character HEBREW ACCENT GERSHAYIM' from the Unicode standard, defined by '\x059e' (╒@·).тunicode-tricksThe combining character HEBREW ACCENT QARNEY PARA' from the Unicode standard, defined by '\x059f' (╒@÷).уunicode-tricksThe combining character HEBREW ACCENT TELISHA GEDOLA' from the Unicode standard, defined by '\x05a0' (╒@═).жunicode-tricksThe combining character HEBREW ACCENT PAZER' from the Unicode standard, defined by '\x05a1' (╒@║).вunicode-tricksThe combining character HEBREW ACCENT ATNAH HAFUKH' from the Unicode standard, defined by '\x05a2' (╒@╒).ьunicode-tricksThe combining character HEBREW ACCENT MUNAH' from the Unicode standard, defined by '\x05a3' (╒@ё).ыunicode-tricksThe combining character HEBREW ACCENT MAHAPAKH' from the Unicode standard, defined by '\x05a4' (╒@є).зunicode-tricksThe combining character HEBREW ACCENT MERKHA' from the Unicode standard, defined by '\x05a5' (╒@╔).шunicode-tricksThe combining character HEBREW ACCENT MERKHA KEFULA' from the Unicode standard, defined by '\x05a6' (╒@і).эunicode-tricksThe combining character HEBREW ACCENT DARGA' from the Unicode standard, defined by '\x05a7' (╒@ї).щunicode-tricksThe combining character HEBREW ACCENT QADMA' from the Unicode standard, defined by '\x05a8' (╒@╗).чunicode-tricksThe combining character HEBREW ACCENT TELISHA QETANA' from the Unicode standard, defined by '\x05a9' (╒@╘).ъunicode-tricksThe combining character HEBREW ACCENT YERAH BEN YOMO' from the Unicode standard, defined by '\x05aa' (╒@╙).Юunicode-tricksThe combining character HEBREW ACCENT OLE' from the Unicode standard, defined by '\x05ab' (╒@╚).Аunicode-tricksThe combining character HEBREW ACCENT ILUY' from the Unicode standard, defined by '\x05ac' (╒@╛).Бunicode-tricksThe combining character HEBREW ACCENT DEHI' from the Unicode standard, defined by '\x05ad' (╒@ґ).Цunicode-tricksThe combining character HEBREW ACCENT ZINOR' from the Unicode standard, defined by '\x05ae' (╒@ў).Дunicode-tricksThe combining character HEBREW MARK MASORA CIRCLE' from the Unicode standard, defined by '\x05af' (╒@╞).Еunicode-tricksThe combining character HEBREW POINT SHEVA' from the Unicode standard, defined by '\x05b0' (╒@╟).Фunicode-tricksThe combining character HEBREW POINT HATAF SEGOL' from the Unicode standard, defined by '\x05b1' (╒@╠).Гunicode-tricksThe combining character HEBREW POINT HATAF PATAH' from the Unicode standard, defined by '\x05b2' (╒@╡).Хunicode-tricksThe combining character HEBREW POINT HATAF QAMATS' from the Unicode standard, defined by '\x05b3' (╒@Ё).Иunicode-tricksThe combining character HEBREW POINT HIRIQ' from the Unicode standard, defined by '\x05b4' (╒@Є).Йunicode-tricksThe combining character HEBREW POINT TSERE' from the Unicode standard, defined by '\x05b5' (╒@╣).Кunicode-tricksThe combining character HEBREW POINT SEGOL' from the Unicode standard, defined by '\x05b6' (╒@І).Лunicode-tricksThe combining character HEBREW POINT PATAH' from the Unicode standard, defined by '\x05b7' (╒@Ї).Мunicode-tricksThe combining character HEBREW POINT QAMATS' from the Unicode standard, defined by '\x05b8' (╒@╦).Нunicode-tricksThe combining character HEBREW POINT HOLAM' from the Unicode standard, defined by '\x05b9' (╒@╧).Оunicode-tricksThe combining character HEBREW POINT HOLAM HASER FOR VAV' from the Unicode standard, defined by '\x05ba' (╒@╨).Пunicode-tricksThe combining character HEBREW POINT QUBUTS' from the Unicode standard, defined by '\x05bb' (╒@╩).Яunicode-tricksThe combining character HEBREW POINT DAGESH OR MAPIQ' from the Unicode standard, defined by '\x05bc' (╒@╪).Рunicode-tricksThe combining character HEBREW POINT METEG' from the Unicode standard, defined by '\x05bd' (╒@Ґ).Сunicode-tricksThe combining character HEBREW POINT RAFE' from the Unicode standard, defined by '\x05bf' (╒@©).Тunicode-tricksThe combining character HEBREW POINT SHIN DOT' from the Unicode standard, defined by '\x05c1' (╒@а).Уunicode-tricksThe combining character HEBREW POINT SIN DOT' from the Unicode standard, defined by '\x05c2' (╒@б).Жunicode-tricksThe combining character HEBREW MARK UPPER DOT' from the Unicode standard, defined by '\x05c4' (╒@д).Вunicode-tricksThe combining character HEBREW MARK LOWER DOT' from the Unicode standard, defined by '\x05c5' (╒@е).Ьunicode-tricksThe combining character HEBREW POINT QAMATS QATAN' from the Unicode standard, defined by '\x05c7' (╒@г).Ыunicode-tricksThe combining character (ARABIC SIGN SALLALLAHOU ALAYHE WASSALLAM' from the Unicode standard, defined by '\x0610' (╒@░).Зunicode-tricksThe combining character ARABIC SIGN ALAYHE ASSALLAM' from the Unicode standard, defined by '\x0611' (╒@▒).Шunicode-tricksThe combining character ARABIC SIGN RAHMATULLAH ALAYHE' from the Unicode standard, defined by '\x0612' (╒@▓).Эunicode-tricksThe combining character ARABIC SIGN RADI ALLAHOU ANHU' from the Unicode standard, defined by '\x0613' (╒@⌠).Щunicode-tricksThe combining character ARABIC SIGN TAKHALLUS' from the Unicode standard, defined by '\x0614' (╒@■).Чunicode-tricksThe combining character ARABIC SMALL HIGH TAH' from the Unicode standard, defined by '\x0615' (╒@∙).Ъunicode-tricksThe combining character 1ARABIC SMALL HIGH LIGATURE ALEF WITH LAM WITH YEH' from the Unicode standard, defined by '\x0616' (╒@√).─unicode-tricksThe combining character ARABIC SMALL HIGH ZAIN' from the Unicode standard, defined by '\x0617' (╒@≈).│unicode-tricksThe combining character ARABIC SMALL FATHA' from the Unicode standard, defined by '\x0618' (╒@≤).┌unicode-tricksThe combining character ARABIC SMALL DAMMA' from the Unicode standard, defined by '\x0619' (╒@≥).┐unicode-tricksThe combining character ARABIC SMALL KASRA' from the Unicode standard, defined by '\x061a' (╒@ ).└unicode-tricksThe combining character ARABIC FATHATAN' from the Unicode standard, defined by '\x064b' (╒@к).┘unicode-tricksThe combining character ARABIC DAMMATAN' from the Unicode standard, defined by '\x064c' (╒@л).├unicode-tricksThe combining character ARABIC KASRATAN' from the Unicode standard, defined by '\x064d' (╒@м).┤unicode-tricksThe combining character ARABIC FATHA' from the Unicode standard, defined by '\x064e' (╒@н).┬unicode-tricksThe combining character ARABIC DAMMA' from the Unicode standard, defined by '\x064f' (╒@о).┴unicode-tricksThe combining character ARABIC KASRA' from the Unicode standard, defined by '\x0650' (╒@п).┼unicode-tricksThe combining character ARABIC SHADDA' from the Unicode standard, defined by '\x0651' (╒@я).▀unicode-tricksThe combining character ARABIC SUKUN' from the Unicode standard, defined by '\x0652' (╒@р).▄unicode-tricksThe combining character ARABIC MADDAH ABOVE' from the Unicode standard, defined by '\x0653' (╒@с).█unicode-tricksThe combining character ARABIC HAMZA ABOVE' from the Unicode standard, defined by '\x0654' (╒@т).▌unicode-tricksThe combining character ARABIC HAMZA BELOW' from the Unicode standard, defined by '\x0655' (╒@у).▐unicode-tricksThe combining character ARABIC SUBSCRIPT ALEF' from the Unicode standard, defined by '\x0656' (╒@ж).░unicode-tricksThe combining character ARABIC INVERTED DAMMA' from the Unicode standard, defined by '\x0657' (╒@в).▒unicode-tricksThe combining character ARABIC MARK NOON GHUNNA' from the Unicode standard, defined by '\x0658' (╒@ь).▓unicode-tricksThe combining character ARABIC ZWARAKAY' from the Unicode standard, defined by '\x0659' (╒@ы).⌠unicode-tricksThe combining character ARABIC VOWEL SIGN SMALL V ABOVE' from the Unicode standard, defined by '\x065a' (╒@з).■unicode-tricksThe combining character (ARABIC VOWEL SIGN INVERTED SMALL V ABOVE' from the Unicode standard, defined by '\x065b' (╒@ш).∙unicode-tricksThe combining character ARABIC VOWEL SIGN DOT BELOW' from the Unicode standard, defined by '\x065c' (╒@э).√unicode-tricksThe combining character ARABIC REVERSED DAMMA' from the Unicode standard, defined by '\x065d' (╒@щ).≈unicode-tricksThe combining character ARABIC FATHA WITH TWO DOTS' from the Unicode standard, defined by '\x065e' (╒@ч).≤unicode-tricksThe combining character ARABIC WAVY HAMZA BELOW' from the Unicode standard, defined by '\x065f' (╒@ъ).≥unicode-tricksThe combining character ARABIC LETTER SUPERSCRIPT ALEF' from the Unicode standard, defined by '\x0670' (╒@П). unicode-tricksThe combining character 9ARABIC SMALL HIGH LIGATURE SAD WITH LAM WITH ALEF MAKSURA' from the Unicode standard, defined by '\x06d6' (╒@ж ).⌡unicode-tricksThe combining character 9ARABIC SMALL HIGH LIGATURE QAF WITH LAM WITH ALEF MAKSURA' from the Unicode standard, defined by '\x06d7' (╒@в ).°unicode-tricksThe combining character #ARABIC SMALL HIGH MEEM INITIAL FORM' from the Unicode standard, defined by '\x06d8' (╒@ь ).²unicode-tricksThe combining character ARABIC SMALL HIGH LAM ALEF' from the Unicode standard, defined by '\x06d9' (╒@ы ).·unicode-tricksThe combining character ARABIC SMALL HIGH JEEM' from the Unicode standard, defined by '\x06da' (╒@з ).÷unicode-tricksThe combining character ARABIC SMALL HIGH THREE DOTS' from the Unicode standard, defined by '\x06db' (╒@ш ).═unicode-tricksThe combining character ARABIC SMALL HIGH SEEN' from the Unicode standard, defined by '\x06dc' (╒@э ).║unicode-tricksThe combining character ARABIC SMALL HIGH ROUNDED ZERO' from the Unicode standard, defined by '\x06df' (╒@ъ ).╒unicode-tricksThe combining character *ARABIC SMALL HIGH UPRIGHT RECTANGULAR ZERO' from the Unicode standard, defined by '\x06e0' (╒@Ю ).ёunicode-tricksThe combining character &ARABIC SMALL HIGH DOTLESS HEAD OF KHAH' from the Unicode standard, defined by '\x06e1' (╒@А ).єunicode-tricksThe combining character $ARABIC SMALL HIGH MEEM ISOLATED FORM' from the Unicode standard, defined by '\x06e2' (╒@Б ).╔unicode-tricksThe combining character ARABIC SMALL LOW SEEN' from the Unicode standard, defined by '\x06e3' (╒@Ц ).іunicode-tricksThe combining character ARABIC SMALL HIGH MADDA' from the Unicode standard, defined by '\x06e4' (╒@Д ).їunicode-tricksThe combining character ARABIC SMALL HIGH YEH' from the Unicode standard, defined by '\x06e7' (╒@Г ).╗unicode-tricksThe combining character ARABIC SMALL HIGH NOON' from the Unicode standard, defined by '\x06e8' (╒@Х ).╘unicode-tricksThe combining character ARABIC EMPTY CENTRE LOW STOP' from the Unicode standard, defined by '\x06ea' (╒@Й ).╙unicode-tricksThe combining character ARABIC EMPTY CENTRE HIGH STOP' from the Unicode standard, defined by '\x06eb' (╒@К ).╚unicode-tricksThe combining character +ARABIC ROUNDED HIGH STOP WITH FILLED CENTRE' from the Unicode standard, defined by '\x06ec' (╒@Л ).╛unicode-tricksThe combining character ARABIC SMALL LOW MEEM' from the Unicode standard, defined by '\x06ed' (╒@М ).ґunicode-tricksThe combining character SYRIAC LETTER SUPERSCRIPT ALAPH' from the Unicode standard, defined by '\x0711' (╒@▒).ўunicode-tricksThe combining character SYRIAC PTHAHA ABOVE' from the Unicode standard, defined by '\x0730' (╒@╟).╞unicode-tricksThe combining character SYRIAC PTHAHA BELOW' from the Unicode standard, defined by '\x0731' (╒@╠).╟unicode-tricksThe combining character SYRIAC PTHAHA DOTTED' from the Unicode standard, defined by '\x0732' (╒@╡).╠unicode-tricksThe combining character SYRIAC ZQAPHA ABOVE' from the Unicode standard, defined by '\x0733' (╒@Ё).╡unicode-tricksThe combining character SYRIAC ZQAPHA BELOW' from the Unicode standard, defined by '\x0734' (╒@Є).Ёunicode-tricksThe combining character SYRIAC ZQAPHA DOTTED' from the Unicode standard, defined by '\x0735' (╒@╣).Єunicode-tricksThe combining character SYRIAC RBASA ABOVE' from the Unicode standard, defined by '\x0736' (╒@І).╣unicode-tricksThe combining character SYRIAC RBASA BELOW' from the Unicode standard, defined by '\x0737' (╒@Ї).Іunicode-tricksThe combining character SYRIAC DOTTED ZLAMA HORIZONTAL' from the Unicode standard, defined by '\x0738' (╒@╦).Їunicode-tricksThe combining character SYRIAC DOTTED ZLAMA ANGULAR' from the Unicode standard, defined by '\x0739' (╒@╧).╦unicode-tricksThe combining character SYRIAC HBASA ABOVE' from the Unicode standard, defined by '\x073a' (╒@╨).╧unicode-tricksThe combining character SYRIAC HBASA BELOW' from the Unicode standard, defined by '\x073b' (╒@╩).╨unicode-tricksThe combining character SYRIAC HBASA-ESASA DOTTED' from the Unicode standard, defined by '\x073c' (╒@╪).╩unicode-tricksThe combining character SYRIAC ESASA ABOVE' from the Unicode standard, defined by '\x073d' (╒@Ґ).╪unicode-tricksThe combining character SYRIAC ESASA BELOW' from the Unicode standard, defined by '\x073e' (╒@Ў).Ґunicode-tricksThe combining character SYRIAC RWAHA' from the Unicode standard, defined by '\x073f' (╒@©).Ўunicode-tricksThe combining character SYRIAC FEMININE DOT' from the Unicode standard, defined by '\x0740' (╒@ю).©unicode-tricksThe combining character SYRIAC QUSHSHAYA' from the Unicode standard, defined by '\x0741' (╒@а).юunicode-tricksThe combining character SYRIAC RUKKAKHA' from the Unicode standard, defined by '\x0742' (╒@б).аunicode-tricksThe combining character SYRIAC TWO VERTICAL DOTS ABOVE' from the Unicode standard, defined by '\x0743' (╒@ц).бunicode-tricksThe combining character SYRIAC TWO VERTICAL DOTS BELOW' from the Unicode standard, defined by '\x0744' (╒@д).цunicode-tricksThe combining character SYRIAC THREE DOTS ABOVE' from the Unicode standard, defined by '\x0745' (╒@е).дunicode-tricksThe combining character SYRIAC THREE DOTS BELOW' from the Unicode standard, defined by '\x0746' (╒@ф).еunicode-tricksThe combining character SYRIAC OBLIQUE LINE ABOVE' from the Unicode standard, defined by '\x0747' (╒@г).фunicode-tricksThe combining character SYRIAC OBLIQUE LINE BELOW' from the Unicode standard, defined by '\x0748' (╒@х).гunicode-tricksThe combining character SYRIAC MUSIC' from the Unicode standard, defined by '\x0749' (╒@и).хunicode-tricksThe combining character SYRIAC BARREKH' from the Unicode standard, defined by '\x074a' (╒@й).иunicode-tricksThe combining character NKO COMBINING SHORT HIGH TONE' from the Unicode standard, defined by '\x07eb' (╒@К).йunicode-tricksThe combining character NKO COMBINING SHORT LOW TONE' from the Unicode standard, defined by '\x07ec' (╒@Л).кunicode-tricksThe combining character NKO COMBINING SHORT RISING TONE' from the Unicode standard, defined by '\x07ed' (╒@М).лunicode-tricksThe combining character "NKO COMBINING LONG DESCENDING TONE' from the Unicode standard, defined by '\x07ee' (╒@Н).мunicode-tricksThe combining character NKO COMBINING LONG HIGH TONE' from the Unicode standard, defined by '\x07ef' (╒@О).нunicode-tricksThe combining character NKO COMBINING LONG LOW TONE' from the Unicode standard, defined by '\x07f0' (╒@П).оunicode-tricksThe combining character NKO COMBINING LONG RISING TONE' from the Unicode standard, defined by '\x07f1' (╒@Я).пunicode-tricksThe combining character NKO COMBINING NASALIZATION MARK' from the Unicode standard, defined by '\x07f2' (╒@Р).яunicode-tricksThe combining character NKO COMBINING DOUBLE DOT ABOVE' from the Unicode standard, defined by '\x07f3' (╒@С).рunicode-tricksThe combining character SAMARITAN MARK IN' from the Unicode standard, defined by '\x0816' (╒@√).сunicode-tricksThe combining character SAMARITAN MARK IN-ALAF' from the Unicode standard, defined by '\x0817' (╒@≈).тunicode-tricksThe combining character SAMARITAN MARK OCCLUSION' from the Unicode standard, defined by '\x0818' (╒@≤).уunicode-tricksThe combining character SAMARITAN MARK DAGESH' from the Unicode standard, defined by '\x0819' (╒@≥).жunicode-tricksThe combining character SAMARITAN MARK EPENTHETIC YUT' from the Unicode standard, defined by '\x081b' (╒@⌡).вunicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG E' from the Unicode standard, defined by '\x081c' (╒@°).ьunicode-tricksThe combining character SAMARITAN VOWEL SIGN E' from the Unicode standard, defined by '\x081d' (╒@²).ыunicode-tricksThe combining character SAMARITAN VOWEL SIGN OVERLONG AA' from the Unicode standard, defined by '\x081e' (╒@·).зunicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG AA' from the Unicode standard, defined by '\x081f' (╒@÷).шunicode-tricksThe combining character SAMARITAN VOWEL SIGN AA' from the Unicode standard, defined by '\x0820' (╒@═).эunicode-tricksThe combining character SAMARITAN VOWEL SIGN OVERLONG A' from the Unicode standard, defined by '\x0821' (╒@║).щunicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG A' from the Unicode standard, defined by '\x0822' (╒@╒).чunicode-tricksThe combining character SAMARITAN VOWEL SIGN A' from the Unicode standard, defined by '\x0823' (╒@ё).ъunicode-tricksThe combining character SAMARITAN VOWEL SIGN SHORT A' from the Unicode standard, defined by '\x0825' (╒@╔).Юunicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG U' from the Unicode standard, defined by '\x0826' (╒@і).Аunicode-tricksThe combining character SAMARITAN VOWEL SIGN U' from the Unicode standard, defined by '\x0827' (╒@ї).Бunicode-tricksThe combining character SAMARITAN VOWEL SIGN LONG I' from the Unicode standard, defined by '\x0829' (╒@╘).Цunicode-tricksThe combining character SAMARITAN VOWEL SIGN I' from the Unicode standard, defined by '\x082a' (╒@╙).Дunicode-tricksThe combining character SAMARITAN VOWEL SIGN O' from the Unicode standard, defined by '\x082b' (╒@╚).Еunicode-tricksThe combining character SAMARITAN VOWEL SIGN SUKUN' from the Unicode standard, defined by '\x082c' (╒@╛).Фunicode-tricksThe combining character SAMARITAN MARK NEQUDAA' from the Unicode standard, defined by '\x082d' (╒@ґ).Гunicode-tricksThe combining character MANDAIC AFFRICATION MARK' from the Unicode standard, defined by '\x0859' (╒@ы).Хunicode-tricksThe combining character MANDAIC VOCALIZATION MARK' from the Unicode standard, defined by '\x085a' (╒@з).Иunicode-tricksThe combining character MANDAIC GEMINATION MARK' from the Unicode standard, defined by '\x085b' (╒@ш).Йunicode-tricksThe combining character ARABIC SMALL HIGH WORD AR-RUB' from the Unicode standard, defined by '\x08d4' (╒@т).Кunicode-tricksThe combining character ARABIC SMALL HIGH SAD' from the Unicode standard, defined by '\x08d5' (╒@у).Лunicode-tricksThe combining character ARABIC SMALL HIGH AIN' from the Unicode standard, defined by '\x08d6' (╒@ж).Мunicode-tricksThe combining character ARABIC SMALL HIGH QAF' from the Unicode standard, defined by '\x08d7' (╒@в).Нunicode-tricksThe combining character !ARABIC SMALL HIGH NOON WITH KASRA' from the Unicode standard, defined by '\x08d8' (╒@ь).Оunicode-tricksThe combining character ARABIC SMALL LOW NOON WITH KASRA' from the Unicode standard, defined by '\x08d9' (╒@ы).Пunicode-tricksThe combining character #ARABIC SMALL HIGH WORD ATH-THALATHA' from the Unicode standard, defined by '\x08da' (╒@з).Яunicode-tricksThe combining character ARABIC SMALL HIGH WORD AS-SAJDA' from the Unicode standard, defined by '\x08db' (╒@ш).Рunicode-tricksThe combining character ARABIC SMALL HIGH WORD AN-NISF' from the Unicode standard, defined by '\x08dc' (╒@э).Сunicode-tricksThe combining character ARABIC SMALL HIGH WORD SAKTA' from the Unicode standard, defined by '\x08dd' (╒@щ).Тunicode-tricksThe combining character ARABIC SMALL HIGH WORD QIF' from the Unicode standard, defined by '\x08de' (╒@ч).Уunicode-tricksThe combining character ARABIC SMALL HIGH WORD WAQFA' from the Unicode standard, defined by '\x08df' (╒@ъ).Жunicode-tricksThe combining character !ARABIC SMALL HIGH FOOTNOTE MARKER' from the Unicode standard, defined by '\x08e0' (╒@Ю).Вunicode-tricksThe combining character ARABIC SMALL HIGH SIGN SAFHA' from the Unicode standard, defined by '\x08e1' (╒@А).Ьunicode-tricksThe combining character ARABIC TURNED DAMMA BELOW' from the Unicode standard, defined by '\x08e3' (╒@Ц).Ыunicode-tricksThe combining character ARABIC CURLY FATHA' from the Unicode standard, defined by '\x08e4' (╒@Д).Зunicode-tricksThe combining character ARABIC CURLY DAMMA' from the Unicode standard, defined by '\x08e5' (╒@Е).Шunicode-tricksThe combining character ARABIC CURLY KASRA' from the Unicode standard, defined by '\x08e6' (╒@Ф).Эunicode-tricksThe combining character ARABIC CURLY FATHATAN' from the Unicode standard, defined by '\x08e7' (╒@Г).Щunicode-tricksThe combining character ARABIC CURLY DAMMATAN' from the Unicode standard, defined by '\x08e8' (╒@Х).Чunicode-tricksThe combining character ARABIC CURLY KASRATAN' from the Unicode standard, defined by '\x08e9' (╒@И).Ъunicode-tricksThe combining character ARABIC TONE ONE DOT ABOVE' from the Unicode standard, defined by '\x08ea' (╒@Й).─unicode-tricksThe combining character ARABIC TONE TWO DOTS ABOVE' from the Unicode standard, defined by '\x08eb' (╒@К).│unicode-tricksThe combining character ARABIC TONE LOOP ABOVE' from the Unicode standard, defined by '\x08ec' (╒@Л).┌unicode-tricksThe combining character ARABIC TONE ONE DOT BELOW' from the Unicode standard, defined by '\x08ed' (╒@М).┐unicode-tricksThe combining character ARABIC TONE TWO DOTS BELOW' from the Unicode standard, defined by '\x08ee' (╒@Н).└unicode-tricksThe combining character ARABIC TONE LOOP BELOW' from the Unicode standard, defined by '\x08ef' (╒@О).┘unicode-tricksThe combining character ARABIC OPEN FATHATAN' from the Unicode standard, defined by '\x08f0' (╒@П).├unicode-tricksThe combining character ARABIC OPEN DAMMATAN' from the Unicode standard, defined by '\x08f1' (╒@Я).┤unicode-tricksThe combining character ARABIC OPEN KASRATAN' from the Unicode standard, defined by '\x08f2' (╒@Р).┬unicode-tricksThe combining character ARABIC SMALL HIGH WAW' from the Unicode standard, defined by '\x08f3' (╒@С).┴unicode-tricksThe combining character ARABIC FATHA WITH RING' from the Unicode standard, defined by '\x08f4' (╒@Т).┼unicode-tricksThe combining character ARABIC FATHA WITH DOT ABOVE' from the Unicode standard, defined by '\x08f5' (╒@У).▀unicode-tricksThe combining character ARABIC KASRA WITH DOT BELOW' from the Unicode standard, defined by '\x08f6' (╒@Ж).▄unicode-tricksThe combining character ARABIC LEFT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x08f7' (╒@В).█unicode-tricksThe combining character ARABIC RIGHT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x08f8' (╒@Ь).▌unicode-tricksThe combining character ARABIC LEFT ARROWHEAD BELOW' from the Unicode standard, defined by '\x08f9' (╒@Ы).▐unicode-tricksThe combining character ARABIC RIGHT ARROWHEAD BELOW' from the Unicode standard, defined by '\x08fa' (╒@З).░unicode-tricksThe combining character #ARABIC DOUBLE RIGHT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x08fb' (╒@Ш).▒unicode-tricksThe combining character ,ARABIC DOUBLE RIGHT ARROWHEAD ABOVE WITH DOT' from the Unicode standard, defined by '\x08fc' (╒@Э).▓unicode-tricksThe combining character %ARABIC RIGHT ARROWHEAD ABOVE WITH DOT' from the Unicode standard, defined by '\x08fd' (╒@Щ).⌠unicode-tricksThe combining character ARABIC DAMMA WITH DOT' from the Unicode standard, defined by '\x08fe' (╒@Ч).■unicode-tricksThe combining character ARABIC MARK SIDEWAYS NOON GHUNNA' from the Unicode standard, defined by '\x08ff' (╒@Ъ).∙unicode-tricksThe combining character DEVANAGARI SIGN NUKTA' from the Unicode standard, defined by '\x093c' (╒@╪).√unicode-tricksThe combining character DEVANAGARI SIGN VIRAMA' from the Unicode standard, defined by '\x094d' (╒@м).≈unicode-tricksThe combining character DEVANAGARI STRESS SIGN UDATTA' from the Unicode standard, defined by '\x0951' (╒@я).≤unicode-tricksThe combining character DEVANAGARI STRESS SIGN ANUDATTA' from the Unicode standard, defined by '\x0952' (╒@р).≥unicode-tricksThe combining character DEVANAGARI GRAVE ACCENT' from the Unicode standard, defined by '\x0953' (╒@с). unicode-tricksThe combining character DEVANAGARI ACUTE ACCENT' from the Unicode standard, defined by '\x0954' (╒@т).⌡unicode-tricksThe combining character BENGALI SIGN NUKTA' from the Unicode standard, defined by '\x09bc' (╒@╪).°unicode-tricksThe combining character BENGALI VOWEL SIGN AA' from the Unicode standard, defined by '\x09be' (╒@Ў).²unicode-tricksThe combining character BENGALI SIGN VIRAMA' from the Unicode standard, defined by '\x09cd' (╒@м).·unicode-tricksThe combining character BENGALI AU LENGTH MARK' from the Unicode standard, defined by '\x09d7' (╒@в).÷unicode-tricksThe combining character GURMUKHI SIGN NUKTA' from the Unicode standard, defined by '\x0a3c' (╒@╪).═unicode-tricksThe combining character GURMUKHI SIGN VIRAMA' from the Unicode standard, defined by '\x0a4d' (╒@м).║unicode-tricksThe combining character GUJARATI SIGN NUKTA' from the Unicode standard, defined by '\x0abc' (╒@╪).╒unicode-tricksThe combining character GUJARATI SIGN VIRAMA' from the Unicode standard, defined by '\x0acd' (╒@м).ёunicode-tricksThe combining character ORIYA SIGN NUKTA' from the Unicode standard, defined by '\x0b3c' (╒@╪).єunicode-tricksThe combining character ORIYA VOWEL SIGN AA' from the Unicode standard, defined by '\x0b3e' (╒@Ў).╔unicode-tricksThe combining character ORIYA SIGN VIRAMA' from the Unicode standard, defined by '\x0b4d' (╒@м).іunicode-tricksThe combining character ORIYA AI LENGTH MARK' from the Unicode standard, defined by '\x0b56' (╒@ж).їunicode-tricksThe combining character ORIYA AU LENGTH MARK' from the Unicode standard, defined by '\x0b57' (╒@в).╗unicode-tricksThe combining character TAMIL VOWEL SIGN AA' from the Unicode standard, defined by '\x0bbe' (╒@Ў).╘unicode-tricksThe combining character TAMIL SIGN VIRAMA' from the Unicode standard, defined by '\x0bcd' (╒@м).╙unicode-tricksThe combining character TAMIL AU LENGTH MARK' from the Unicode standard, defined by '\x0bd7' (╒@в).╚unicode-tricksThe combining character TELUGU SIGN VIRAMA' from the Unicode standard, defined by '\x0c4d' (╒@м).╛unicode-tricksThe combining character TELUGU LENGTH MARK' from the Unicode standard, defined by '\x0c55' (╒@у).ґunicode-tricksThe combining character TELUGU AI LENGTH MARK' from the Unicode standard, defined by '\x0c56' (╒@ж).ўunicode-tricksThe combining character KANNADA SIGN NUKTA' from the Unicode standard, defined by '\x0cbc' (╒@╪).╞unicode-tricksThe combining character KANNADA VOWEL SIGN UU' from the Unicode standard, defined by '\x0cc2' (╒@б).╟unicode-tricksThe combining character KANNADA SIGN VIRAMA' from the Unicode standard, defined by '\x0ccd' (╒@м).╠unicode-tricksThe combining character KANNADA LENGTH MARK' from the Unicode standard, defined by '\x0cd5' (╒@у).╡unicode-tricksThe combining character KANNADA AI LENGTH MARK' from the Unicode standard, defined by '\x0cd6' (╒@ж).Ёunicode-tricksThe combining character MALAYALAM VOWEL SIGN AA' from the Unicode standard, defined by '\x0d3e' (╒@Ў).Єunicode-tricksThe combining character MALAYALAM SIGN VIRAMA' from the Unicode standard, defined by '\x0d4d' (╒@м).╣unicode-tricksThe combining character MALAYALAM AU LENGTH MARK' from the Unicode standard, defined by '\x0d57' (╒@в).Іunicode-tricksThe combining character SINHALA SIGN AL-LAKUNA' from the Unicode standard, defined by '\x0dca' (╒@й).Їunicode-tricksThe combining character SINHALA VOWEL SIGN AELA-PILLA' from the Unicode standard, defined by '\x0dcf' (╒@о).╦unicode-tricksThe combining character SINHALA VOWEL SIGN GAYANUKITTA' from the Unicode standard, defined by '\x0ddf' (╒@ъ).╧unicode-tricksThe combining character THAI CHARACTER SARA U' from the Unicode standard, defined by '\x0e38' (╒@╦).╨unicode-tricksThe combining character THAI CHARACTER SARA UU' from the Unicode standard, defined by '\x0e39' (╒@╧).╩unicode-tricksThe combining character THAI CHARACTER PHINTHU' from the Unicode standard, defined by '\x0e3a' (╒@╨).╪unicode-tricksThe combining character THAI CHARACTER MAI EK' from the Unicode standard, defined by '\x0e48' (╒@х).Ґunicode-tricksThe combining character THAI CHARACTER MAI THO' from the Unicode standard, defined by '\x0e49' (╒@и).Ўunicode-tricksThe combining character THAI CHARACTER MAI TRI' from the Unicode standard, defined by '\x0e4a' (╒@й).©unicode-tricksThe combining character THAI CHARACTER MAI CHATTAWA' from the Unicode standard, defined by '\x0e4b' (╒@к).юunicode-tricksThe combining character LAO VOWEL SIGN U' from the Unicode standard, defined by '\x0eb8' (╒@╦).аunicode-tricksThe combining character LAO VOWEL SIGN UU' from the Unicode standard, defined by '\x0eb9' (╒@╧).бunicode-tricksThe combining character LAO TONE MAI EK' from the Unicode standard, defined by '\x0ec8' (╒@х).цunicode-tricksThe combining character LAO TONE MAI THO' from the Unicode standard, defined by '\x0ec9' (╒@и).дunicode-tricksThe combining character LAO TONE MAI TI' from the Unicode standard, defined by '\x0eca' (╒@й).еunicode-tricksThe combining character LAO TONE MAI CATAWA' from the Unicode standard, defined by '\x0ecb' (╒@к).фunicode-tricksThe combining character #TIBETAN ASTROLOGICAL SIGN -KHYUD PA' from the Unicode standard, defined by '\x0f18' (╒@≤).гunicode-tricksThe combining character &TIBETAN ASTROLOGICAL SIGN SDONG TSHUGS' from the Unicode standard, defined by '\x0f19' (╒@≥).хunicode-tricksThe combining character TIBETAN MARK NGAS BZUNG NYI ZLA' from the Unicode standard, defined by '\x0f35' (╒@╣).иunicode-tricksThe combining character "TIBETAN MARK NGAS BZUNG SGOR RTAGS' from the Unicode standard, defined by '\x0f37' (╒@Ї).йunicode-tricksThe combining character TIBETAN MARK TSA -PHRU' from the Unicode standard, defined by '\x0f39' (╒@╧).кunicode-tricksThe combining character TIBETAN VOWEL SIGN AA' from the Unicode standard, defined by '\x0f71' (╒@Я).лunicode-tricksThe combining character TIBETAN VOWEL SIGN I' from the Unicode standard, defined by '\x0f72' (╒@Р).мunicode-tricksThe combining character TIBETAN VOWEL SIGN U' from the Unicode standard, defined by '\x0f74' (╒@Т).нunicode-tricksThe combining character TIBETAN VOWEL SIGN E' from the Unicode standard, defined by '\x0f7a' (╒@З).оunicode-tricksThe combining character TIBETAN VOWEL SIGN EE' from the Unicode standard, defined by '\x0f7b' (╒@Ш).пunicode-tricksThe combining character TIBETAN VOWEL SIGN O' from the Unicode standard, defined by '\x0f7c' (╒@Э).яunicode-tricksThe combining character TIBETAN VOWEL SIGN OO' from the Unicode standard, defined by '\x0f7d' (╒@Щ).рunicode-tricksThe combining character TIBETAN VOWEL SIGN REVERSED I' from the Unicode standard, defined by '\x0f80' (╒@─).сunicode-tricksThe combining character TIBETAN SIGN NYI ZLA NAA DA' from the Unicode standard, defined by '\x0f82' (╒@┌).тunicode-tricksThe combining character TIBETAN SIGN SNA LDAN' from the Unicode standard, defined by '\x0f83' (╒@┐).уunicode-tricksThe combining character TIBETAN MARK HALANTA' from the Unicode standard, defined by '\x0f84' (╒@└).жunicode-tricksThe combining character TIBETAN SIGN LCI RTAGS' from the Unicode standard, defined by '\x0f86' (╒@├).вunicode-tricksThe combining character TIBETAN SIGN YANG RTAGS' from the Unicode standard, defined by '\x0f87' (╒@┤).ьunicode-tricksThe combining character TIBETAN SUBJOINED LETTER SSA' from the Unicode standard, defined by '\x0fb5' (╒@╣).ыunicode-tricksThe combining character TIBETAN SUBJOINED LETTER HA' from the Unicode standard, defined by '\x0fb7' (╒@Ї).зunicode-tricksThe combining character TIBETAN SYMBOL PADMA GDAN' from the Unicode standard, defined by '\x0fc6' (╒@ф).шunicode-tricksThe combining character MYANMAR VOWEL SIGN II' from the Unicode standard, defined by '\x102e' (╒@ў ).эunicode-tricksThe combining character MYANMAR SIGN DOT BELOW' from the Unicode standard, defined by '\x1037' (╒@Ї ).щunicode-tricksThe combining character MYANMAR SIGN VIRAMA' from the Unicode standard, defined by '\x1039' (╒@╧ ).чunicode-tricksThe combining character MYANMAR SIGN ASAT' from the Unicode standard, defined by '\x103a' (╒@╨ ).ъunicode-tricksThe combining character 'MYANMAR SIGN SHAN COUNCIL EMPHATIC TONE' from the Unicode standard, defined by '\x108d' (╒@█!).Юunicode-tricksThe combining character 3ETHIOPIC COMBINING GEMINATION AND VOWEL LENGTH MARK' from the Unicode standard, defined by '\x135d' (╒@щ&).Аunicode-tricksThe combining character $ETHIOPIC COMBINING VOWEL LENGTH MARK' from the Unicode standard, defined by '\x135e' (╒@ч&).Бunicode-tricksThe combining character "ETHIOPIC COMBINING GEMINATION MARK' from the Unicode standard, defined by '\x135f' (╒@ъ&).Цunicode-tricksThe combining character TAGALOG SIGN VIRAMA' from the Unicode standard, defined by '\x1714' (╒@■.).Дunicode-tricksThe combining character HANUNOO SIGN PAMUDPOD' from the Unicode standard, defined by '\x1734' (╒@Є.).Еunicode-tricksThe combining character KHMER SIGN COENG' from the Unicode standard, defined by '\x17d2' (╒@р/).Фunicode-tricksThe combining character KHMER SIGN ATTHACAN' from the Unicode standard, defined by '\x17dd' (╒@щ/).Гunicode-tricksThe combining character !MONGOLIAN LETTER ALI GALI DAGALGA' from the Unicode standard, defined by '\x18a9' (╒@╘1).Хunicode-tricksThe combining character LIMBU SIGN MUKPHRENG' from the Unicode standard, defined by '\x1939' (╒@╧2).Иunicode-tricksThe combining character LIMBU SIGN KEMPHRENG' from the Unicode standard, defined by '\x193a' (╒@╨2).Йunicode-tricksThe combining character LIMBU SIGN SA-I' from the Unicode standard, defined by '\x193b' (╒@╩2).Кunicode-tricksThe combining character BUGINESE VOWEL SIGN I' from the Unicode standard, defined by '\x1a17' (╒@≈4).Лunicode-tricksThe combining character BUGINESE VOWEL SIGN U' from the Unicode standard, defined by '\x1a18' (╒@≤4).Мunicode-tricksThe combining character TAI THAM SIGN SAKOT' from the Unicode standard, defined by '\x1a60' (╒@Ю4).Нunicode-tricksThe combining character TAI THAM SIGN TONE-1' from the Unicode standard, defined by '\x1a75' (╒@У4).Оunicode-tricksThe combining character TAI THAM SIGN TONE-2' from the Unicode standard, defined by '\x1a76' (╒@Ж4).Пunicode-tricksThe combining character TAI THAM SIGN KHUEN TONE-3' from the Unicode standard, defined by '\x1a77' (╒@В4).Яunicode-tricksThe combining character TAI THAM SIGN KHUEN TONE-4' from the Unicode standard, defined by '\x1a78' (╒@Ь4).Рunicode-tricksThe combining character TAI THAM SIGN KHUEN TONE-5' from the Unicode standard, defined by '\x1a79' (╒@Ы4).Сunicode-tricksThe combining character TAI THAM SIGN RA HAAM' from the Unicode standard, defined by '\x1a7a' (╒@З4).Тunicode-tricksThe combining character TAI THAM SIGN MAI SAM' from the Unicode standard, defined by '\x1a7b' (╒@Ш4).Уunicode-tricksThe combining character TAI THAM SIGN KHUEN-LUE KARAN' from the Unicode standard, defined by '\x1a7c' (╒@Э4).Жunicode-tricksThe combining character $TAI THAM COMBINING CRYPTOGRAMMIC DOT' from the Unicode standard, defined by '\x1a7f' (╒@Ъ4).Вunicode-tricksThe combining character #COMBINING DOUBLED CIRCUMFLEX ACCENT' from the Unicode standard, defined by '\x1ab0' (╒@╟5).Ьunicode-tricksThe combining character COMBINING DIAERESIS-RING' from the Unicode standard, defined by '\x1ab1' (╒@╠5).Ыunicode-tricksThe combining character COMBINING INFINITY' from the Unicode standard, defined by '\x1ab2' (╒@╡5).Зunicode-tricksThe combining character COMBINING DOWNWARDS ARROW' from the Unicode standard, defined by '\x1ab3' (╒@Ё5).Шunicode-tricksThe combining character COMBINING TRIPLE DOT' from the Unicode standard, defined by '\x1ab4' (╒@Є5).Эunicode-tricksThe combining character COMBINING X-X BELOW' from the Unicode standard, defined by '\x1ab5' (╒@╣5).Щunicode-tricksThe combining character COMBINING WIGGLY LINE BELOW' from the Unicode standard, defined by '\x1ab6' (╒@І5).Чunicode-tricksThe combining character COMBINING OPEN MARK BELOW' from the Unicode standard, defined by '\x1ab7' (╒@Ї5).Ъunicode-tricksThe combining character COMBINING DOUBLE OPEN MARK BELOW' from the Unicode standard, defined by '\x1ab8' (╒@╦5).─unicode-tricksThe combining character +COMBINING LIGHT CENTRALIZATION STROKE BELOW' from the Unicode standard, defined by '\x1ab9' (╒@╧5).│unicode-tricksThe combining character ,COMBINING STRONG CENTRALIZATION STROKE BELOW' from the Unicode standard, defined by '\x1aba' (╒@╨5).┌unicode-tricksThe combining character COMBINING PARENTHESES ABOVE' from the Unicode standard, defined by '\x1abb' (╒@╩5).┐unicode-tricksThe combining character "COMBINING DOUBLE PARENTHESES ABOVE' from the Unicode standard, defined by '\x1abc' (╒@╪5).└unicode-tricksThe combining character COMBINING PARENTHESES BELOW' from the Unicode standard, defined by '\x1abd' (╒@Ґ5).┘unicode-tricksThe combining character BALINESE SIGN REREKAN' from the Unicode standard, defined by '\x1b34' (╒@Є6).├unicode-tricksThe combining character BALINESE VOWEL SIGN TEDUNG' from the Unicode standard, defined by '\x1b35' (╒@╣6).┤unicode-tricksThe combining character BALINESE ADEG ADEG' from the Unicode standard, defined by '\x1b44' (╒@д6).┬unicode-tricksThe combining character 'BALINESE MUSICAL SYMBOL COMBINING TEGEH' from the Unicode standard, defined by '\x1b6b' (╒@К6).┴unicode-tricksThe combining character 'BALINESE MUSICAL SYMBOL COMBINING ENDEP' from the Unicode standard, defined by '\x1b6c' (╒@Л6).┼unicode-tricksThe combining character (BALINESE MUSICAL SYMBOL COMBINING KEMPUL' from the Unicode standard, defined by '\x1b6d' (╒@М6).▀unicode-tricksThe combining character (BALINESE MUSICAL SYMBOL COMBINING KEMPLI' from the Unicode standard, defined by '\x1b6e' (╒@Н6).▄unicode-tricksThe combining character )BALINESE MUSICAL SYMBOL COMBINING JEGOGAN' from the Unicode standard, defined by '\x1b6f' (╒@О6).█unicode-tricksThe combining character 5BALINESE MUSICAL SYMBOL COMBINING KEMPUL WITH JEGOGAN' from the Unicode standard, defined by '\x1b70' (╒@П6).▌unicode-tricksThe combining character 5BALINESE MUSICAL SYMBOL COMBINING KEMPLI WITH JEGOGAN' from the Unicode standard, defined by '\x1b71' (╒@Я6).▐unicode-tricksThe combining character 'BALINESE MUSICAL SYMBOL COMBINING BENDE' from the Unicode standard, defined by '\x1b72' (╒@Р6).░unicode-tricksThe combining character &BALINESE MUSICAL SYMBOL COMBINING GONG' from the Unicode standard, defined by '\x1b73' (╒@С6).▒unicode-tricksThe combining character SUNDANESE SIGN PAMAAEH' from the Unicode standard, defined by '\x1baa' (╒@╙7).▓unicode-tricksThe combining character SUNDANESE SIGN VIRAMA' from the Unicode standard, defined by '\x1bab' (╒@╚7).⌠unicode-tricksThe combining character BATAK SIGN TOMPI' from the Unicode standard, defined by '\x1be6' (╒@Ф7).■unicode-tricksThe combining character BATAK PANGOLAT' from the Unicode standard, defined by '\x1bf2' (╒@Р7).∙unicode-tricksThe combining character BATAK PANONGONAN' from the Unicode standard, defined by '\x1bf3' (╒@С7).√unicode-tricksThe combining character LEPCHA SIGN NUKTA' from the Unicode standard, defined by '\x1c37' (╒@Ї8).≈unicode-tricksThe combining character VEDIC TONE KARSHANA' from the Unicode standard, defined by '\x1cd0' (╒@п9).≤unicode-tricksThe combining character VEDIC TONE SHARA' from the Unicode standard, defined by '\x1cd1' (╒@я9).≥unicode-tricksThe combining character VEDIC TONE PRENKHA' from the Unicode standard, defined by '\x1cd2' (╒@р9). unicode-tricksThe combining character %VEDIC SIGN YAJURVEDIC MIDLINE SVARITA' from the Unicode standard, defined by '\x1cd4' (╒@т9).⌡unicode-tricksThe combining character 4VEDIC TONE YAJURVEDIC AGGRAVATED INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1cd5' (╒@у9).°unicode-tricksThe combining character )VEDIC TONE YAJURVEDIC INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1cd6' (╒@ж9).²unicode-tricksThe combining character 1VEDIC TONE YAJURVEDIC KATHAKA INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1cd7' (╒@в9).·unicode-tricksThe combining character VEDIC TONE CANDRA BELOW' from the Unicode standard, defined by '\x1cd8' (╒@ь9).÷unicode-tricksThe combining character ;VEDIC TONE YAJURVEDIC KATHAKA INDEPENDENT SVARITA SCHROEDER' from the Unicode standard, defined by '\x1cd9' (╒@ы9).═unicode-tricksThe combining character VEDIC TONE DOUBLE SVARITA' from the Unicode standard, defined by '\x1cda' (╒@з9).║unicode-tricksThe combining character VEDIC TONE TRIPLE SVARITA' from the Unicode standard, defined by '\x1cdb' (╒@ш9).╒unicode-tricksThe combining character VEDIC TONE KATHAKA ANUDATTA' from the Unicode standard, defined by '\x1cdc' (╒@э9).ёunicode-tricksThe combining character VEDIC TONE DOT BELOW' from the Unicode standard, defined by '\x1cdd' (╒@щ9).єunicode-tricksThe combining character VEDIC TONE TWO DOTS BELOW' from the Unicode standard, defined by '\x1cde' (╒@ч9).╔unicode-tricksThe combining character VEDIC TONE THREE DOTS BELOW' from the Unicode standard, defined by '\x1cdf' (╒@ъ9).іunicode-tricksThe combining character 0VEDIC TONE RIGVEDIC KASHMIRI INDEPENDENT SVARITA' from the Unicode standard, defined by '\x1ce0' (╒@Ю9).їunicode-tricksThe combining character VEDIC SIGN VISARGA SVARITA' from the Unicode standard, defined by '\x1ce2' (╒@Б9).╗unicode-tricksThe combining character VEDIC SIGN VISARGA UDATTA' from the Unicode standard, defined by '\x1ce3' (╒@Ц9).╘unicode-tricksThe combining character "VEDIC SIGN REVERSED VISARGA UDATTA' from the Unicode standard, defined by '\x1ce4' (╒@Д9).╙unicode-tricksThe combining character VEDIC SIGN VISARGA ANUDATTA' from the Unicode standard, defined by '\x1ce5' (╒@Е9).╚unicode-tricksThe combining character $VEDIC SIGN REVERSED VISARGA ANUDATTA' from the Unicode standard, defined by '\x1ce6' (╒@Ф9).╛unicode-tricksThe combining character #VEDIC SIGN VISARGA UDATTA WITH TAIL' from the Unicode standard, defined by '\x1ce7' (╒@Г9).ґunicode-tricksThe combining character %VEDIC SIGN VISARGA ANUDATTA WITH TAIL' from the Unicode standard, defined by '\x1ce8' (╒@Х9).ўunicode-tricksThe combining character VEDIC SIGN TIRYAK' from the Unicode standard, defined by '\x1ced' (╒@М9).╞unicode-tricksThe combining character VEDIC TONE CANDRA ABOVE' from the Unicode standard, defined by '\x1cf4' (╒@Т9).╟unicode-tricksThe combining character VEDIC TONE RING ABOVE' from the Unicode standard, defined by '\x1cf8' (╒@Ь9).╠unicode-tricksThe combining character VEDIC TONE DOUBLE RING ABOVE' from the Unicode standard, defined by '\x1cf9' (╒@Ы9).╡unicode-tricksThe combining character COMBINING DOTTED GRAVE ACCENT' from the Unicode standard, defined by '\x1dc0' (╒@ю;).Ёunicode-tricksThe combining character COMBINING DOTTED ACUTE ACCENT' from the Unicode standard, defined by '\x1dc1' (╒@а;).Єunicode-tricksThe combining character COMBINING SNAKE BELOW' from the Unicode standard, defined by '\x1dc2' (╒@б;).╣unicode-tricksThe combining character COMBINING SUSPENSION MARK' from the Unicode standard, defined by '\x1dc3' (╒@ц;).Іunicode-tricksThe combining character COMBINING MACRON-ACUTE' from the Unicode standard, defined by '\x1dc4' (╒@д;).Їunicode-tricksThe combining character COMBINING GRAVE-MACRON' from the Unicode standard, defined by '\x1dc5' (╒@е;).╦unicode-tricksThe combining character COMBINING MACRON-GRAVE' from the Unicode standard, defined by '\x1dc6' (╒@ф;).╧unicode-tricksThe combining character COMBINING ACUTE-MACRON' from the Unicode standard, defined by '\x1dc7' (╒@г;).╨unicode-tricksThe combining character COMBINING GRAVE-ACUTE-GRAVE' from the Unicode standard, defined by '\x1dc8' (╒@х;).╩unicode-tricksThe combining character COMBINING ACUTE-GRAVE-ACUTE' from the Unicode standard, defined by '\x1dc9' (╒@и;).╪unicode-tricksThe combining character $COMBINING LATIN SMALL LETTER R BELOW' from the Unicode standard, defined by '\x1dca' (╒@й;).Ґunicode-tricksThe combining character COMBINING BREVE-MACRON' from the Unicode standard, defined by '\x1dcb' (╒@к;).Ўunicode-tricksThe combining character COMBINING MACRON-BREVE' from the Unicode standard, defined by '\x1dcc' (╒@л;).©unicode-tricksThe combining character !COMBINING DOUBLE CIRCUMFLEX ABOVE' from the Unicode standard, defined by '\x1dcd' (╒@м;).юunicode-tricksThe combining character COMBINING OGONEK ABOVE' from the Unicode standard, defined by '\x1dce' (╒@н;).аunicode-tricksThe combining character COMBINING ZIGZAG BELOW' from the Unicode standard, defined by '\x1dcf' (╒@о;).бunicode-tricksThe combining character COMBINING IS BELOW' from the Unicode standard, defined by '\x1dd0' (╒@п;).цunicode-tricksThe combining character COMBINING UR ABOVE' from the Unicode standard, defined by '\x1dd1' (╒@я;).дunicode-tricksThe combining character COMBINING US ABOVE' from the Unicode standard, defined by '\x1dd2' (╒@р;).еunicode-tricksThe combining character 3COMBINING LATIN SMALL LETTER FLATTENED OPEN A ABOVE' from the Unicode standard, defined by '\x1dd3' (╒@с;).фunicode-tricksThe combining character COMBINING LATIN SMALL LETTER AE' from the Unicode standard, defined by '\x1dd4' (╒@т;).гunicode-tricksThe combining character COMBINING LATIN SMALL LETTER AO' from the Unicode standard, defined by '\x1dd5' (╒@у;).хunicode-tricksThe combining character COMBINING LATIN SMALL LETTER AV' from the Unicode standard, defined by '\x1dd6' (╒@ж;).иunicode-tricksThe combining character &COMBINING LATIN SMALL LETTER C CEDILLA' from the Unicode standard, defined by '\x1dd7' (╒@в;).йunicode-tricksThe combining character &COMBINING LATIN SMALL LETTER INSULAR D' from the Unicode standard, defined by '\x1dd8' (╒@ь;).кunicode-tricksThe combining character COMBINING LATIN SMALL LETTER ETH' from the Unicode standard, defined by '\x1dd9' (╒@ы;).лunicode-tricksThe combining character COMBINING LATIN SMALL LETTER G' from the Unicode standard, defined by '\x1dda' (╒@з;).мunicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL G' from the Unicode standard, defined by '\x1ddb' (╒@ш;).нunicode-tricksThe combining character COMBINING LATIN SMALL LETTER K' from the Unicode standard, defined by '\x1ddc' (╒@э;).оunicode-tricksThe combining character COMBINING LATIN SMALL LETTER L' from the Unicode standard, defined by '\x1ddd' (╒@щ;).пunicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL L' from the Unicode standard, defined by '\x1dde' (╒@ч;).яunicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL M' from the Unicode standard, defined by '\x1ddf' (╒@ъ;).рunicode-tricksThe combining character COMBINING LATIN SMALL LETTER N' from the Unicode standard, defined by '\x1de0' (╒@Ю;).сunicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL N' from the Unicode standard, defined by '\x1de1' (╒@А;).тunicode-tricksThe combining character &COMBINING LATIN LETTER SMALL CAPITAL R' from the Unicode standard, defined by '\x1de2' (╒@Б;).уunicode-tricksThe combining character &COMBINING LATIN SMALL LETTER R ROTUNDA' from the Unicode standard, defined by '\x1de3' (╒@Ц;).жunicode-tricksThe combining character COMBINING LATIN SMALL LETTER S' from the Unicode standard, defined by '\x1de4' (╒@Д;).вunicode-tricksThe combining character #COMBINING LATIN SMALL LETTER LONG S' from the Unicode standard, defined by '\x1de5' (╒@Е;).ьunicode-tricksThe combining character COMBINING LATIN SMALL LETTER Z' from the Unicode standard, defined by '\x1de6' (╒@Ф;).ыunicode-tricksThe combining character "COMBINING LATIN SMALL LETTER ALPHA' from the Unicode standard, defined by '\x1de7' (╒@Г;).зunicode-tricksThe combining character COMBINING LATIN SMALL LETTER B' from the Unicode standard, defined by '\x1de8' (╒@Х;).шunicode-tricksThe combining character !COMBINING LATIN SMALL LETTER BETA' from the Unicode standard, defined by '\x1de9' (╒@И;).эunicode-tricksThe combining character "COMBINING LATIN SMALL LETTER SCHWA' from the Unicode standard, defined by '\x1dea' (╒@Й;).щunicode-tricksThe combining character COMBINING LATIN SMALL LETTER F' from the Unicode standard, defined by '\x1deb' (╒@К;).чunicode-tricksThe combining character 7COMBINING LATIN SMALL LETTER L WITH DOUBLE MIDDLE TILDE' from the Unicode standard, defined by '\x1dec' (╒@Л;).ъunicode-tricksThe combining character ?COMBINING LATIN SMALL LETTER O WITH LIGHT CENTRALIZATION STROKE' from the Unicode standard, defined by '\x1ded' (╒@М;).Юunicode-tricksThe combining character COMBINING LATIN SMALL LETTER P' from the Unicode standard, defined by '\x1dee' (╒@Н;).Аunicode-tricksThe combining character COMBINING LATIN SMALL LETTER ESH' from the Unicode standard, defined by '\x1def' (╒@О;).Бunicode-tricksThe combining character ?COMBINING LATIN SMALL LETTER U WITH LIGHT CENTRALIZATION STROKE' from the Unicode standard, defined by '\x1df0' (╒@П;).Цunicode-tricksThe combining character COMBINING LATIN SMALL LETTER W' from the Unicode standard, defined by '\x1df1' (╒@Я;).Дunicode-tricksThe combining character -COMBINING LATIN SMALL LETTER A WITH DIAERESIS' from the Unicode standard, defined by '\x1df2' (╒@Р;).Еunicode-tricksThe combining character -COMBINING LATIN SMALL LETTER O WITH DIAERESIS' from the Unicode standard, defined by '\x1df3' (╒@С;).Фunicode-tricksThe combining character -COMBINING LATIN SMALL LETTER U WITH DIAERESIS' from the Unicode standard, defined by '\x1df4' (╒@Т;).Гunicode-tricksThe combining character COMBINING UP TACK ABOVE' from the Unicode standard, defined by '\x1df5' (╒@У;).Хunicode-tricksThe combining character COMBINING DELETION MARK' from the Unicode standard, defined by '\x1dfb' (╒@Ш;).Иunicode-tricksThe combining character %COMBINING DOUBLE INVERTED BREVE BELOW' from the Unicode standard, defined by '\x1dfc' (╒@Э;).Йunicode-tricksThe combining character COMBINING ALMOST EQUAL TO BELOW' from the Unicode standard, defined by '\x1dfd' (╒@Щ;).Кunicode-tricksThe combining character COMBINING LEFT ARROWHEAD ABOVE' from the Unicode standard, defined by '\x1dfe' (╒@Ч;).Лunicode-tricksThe combining character 2COMBINING RIGHT ARROWHEAD AND DOWN ARROWHEAD BELOW' from the Unicode standard, defined by '\x1dff' (╒@Ъ;).Мunicode-tricksThe combining character COMBINING LEFT HARPOON ABOVE' from the Unicode standard, defined by '\x20d0' (╒@пA).Нunicode-tricksThe combining character COMBINING RIGHT HARPOON ABOVE' from the Unicode standard, defined by '\x20d1' (╒@яA).Оunicode-tricksThe combining character $COMBINING LONG VERTICAL LINE OVERLAY' from the Unicode standard, defined by '\x20d2' (╒@рA).Пunicode-tricksThe combining character %COMBINING SHORT VERTICAL LINE OVERLAY' from the Unicode standard, defined by '\x20d3' (╒@сA).Яunicode-tricksThe combining character #COMBINING ANTICLOCKWISE ARROW ABOVE' from the Unicode standard, defined by '\x20d4' (╒@тA).Рunicode-tricksThe combining character COMBINING CLOCKWISE ARROW ABOVE' from the Unicode standard, defined by '\x20d5' (╒@уA).Сunicode-tricksThe combining character COMBINING LEFT ARROW ABOVE' from the Unicode standard, defined by '\x20d6' (╒@жA).Тunicode-tricksThe combining character COMBINING RIGHT ARROW ABOVE' from the Unicode standard, defined by '\x20d7' (╒@вA).Уunicode-tricksThe combining character COMBINING RING OVERLAY' from the Unicode standard, defined by '\x20d8' (╒@ьA).Жunicode-tricksThe combining character COMBINING CLOCKWISE RING OVERLAY' from the Unicode standard, defined by '\x20d9' (╒@ыA).Вunicode-tricksThe combining character $COMBINING ANTICLOCKWISE RING OVERLAY' from the Unicode standard, defined by '\x20da' (╒@зA).Ьunicode-tricksThe combining character COMBINING THREE DOTS ABOVE' from the Unicode standard, defined by '\x20db' (╒@шA).Ыunicode-tricksThe combining character COMBINING FOUR DOTS ABOVE' from the Unicode standard, defined by '\x20dc' (╒@эA).Зunicode-tricksThe combining character COMBINING LEFT RIGHT ARROW ABOVE' from the Unicode standard, defined by '\x20e1' (╒@АA).Шunicode-tricksThe combining character !COMBINING REVERSE SOLIDUS OVERLAY' from the Unicode standard, defined by '\x20e5' (╒@ЕA).Эunicode-tricksThe combining character (COMBINING DOUBLE VERTICAL STROKE OVERLAY' from the Unicode standard, defined by '\x20e6' (╒@ФA).Щunicode-tricksThe combining character COMBINING ANNUITY SYMBOL' from the Unicode standard, defined by '\x20e7' (╒@ГA).Чunicode-tricksThe combining character COMBINING TRIPLE UNDERDOT' from the Unicode standard, defined by '\x20e8' (╒@ХA).Ъunicode-tricksThe combining character COMBINING WIDE BRIDGE ABOVE' from the Unicode standard, defined by '\x20e9' (╒@ИA).─unicode-tricksThe combining character !COMBINING LEFTWARDS ARROW OVERLAY' from the Unicode standard, defined by '\x20ea' (╒@ЙA).│unicode-tricksThe combining character %COMBINING LONG DOUBLE SOLIDUS OVERLAY' from the Unicode standard, defined by '\x20eb' (╒@КA).┌unicode-tricksThe combining character 0COMBINING RIGHTWARDS HARPOON WITH BARB DOWNWARDS' from the Unicode standard, defined by '\x20ec' (╒@ЛA).┐unicode-tricksThe combining character /COMBINING LEFTWARDS HARPOON WITH BARB DOWNWARDS' from the Unicode standard, defined by '\x20ed' (╒@МA).└unicode-tricksThe combining character COMBINING LEFT ARROW BELOW' from the Unicode standard, defined by '\x20ee' (╒@НA).┘unicode-tricksThe combining character COMBINING RIGHT ARROW BELOW' from the Unicode standard, defined by '\x20ef' (╒@ОA).├unicode-tricksThe combining character COMBINING ASTERISK ABOVE' from the Unicode standard, defined by '\x20f0' (╒@ПA).┤unicode-tricksThe combining character COPTIC COMBINING NI ABOVE' from the Unicode standard, defined by '\x2cef' (╒@ОY).┬unicode-tricksThe combining character COPTIC COMBINING SPIRITUS ASPER' from the Unicode standard, defined by '\x2cf0' (╒@ПY).┴unicode-tricksThe combining character COPTIC COMBINING SPIRITUS LENIS' from the Unicode standard, defined by '\x2cf1' (╒@ЯY).┼unicode-tricksThe combining character TIFINAGH CONSONANT JOINER' from the Unicode standard, defined by '\x2d7f' (╒@ЪZ).▀unicode-tricksThe combining character COMBINING CYRILLIC LETTER BE' from the Unicode standard, defined by '\x2de0' (╒@Ю[).▄unicode-tricksThe combining character COMBINING CYRILLIC LETTER VE' from the Unicode standard, defined by '\x2de1' (╒@А[).█unicode-tricksThe combining character COMBINING CYRILLIC LETTER GHE' from the Unicode standard, defined by '\x2de2' (╒@Б[).▌unicode-tricksThe combining character COMBINING CYRILLIC LETTER DE' from the Unicode standard, defined by '\x2de3' (╒@Ц[).▐unicode-tricksThe combining character COMBINING CYRILLIC LETTER ZHE' from the Unicode standard, defined by '\x2de4' (╒@Д[).░unicode-tricksThe combining character COMBINING CYRILLIC LETTER ZE' from the Unicode standard, defined by '\x2de5' (╒@Е[).▒unicode-tricksThe combining character COMBINING CYRILLIC LETTER KA' from the Unicode standard, defined by '\x2de6' (╒@Ф[).▓unicode-tricksThe combining character COMBINING CYRILLIC LETTER EL' from the Unicode standard, defined by '\x2de7' (╒@Г[).⌠unicode-tricksThe combining character COMBINING CYRILLIC LETTER EM' from the Unicode standard, defined by '\x2de8' (╒@Х[).■unicode-tricksThe combining character COMBINING CYRILLIC LETTER EN' from the Unicode standard, defined by '\x2de9' (╒@И[).∙unicode-tricksThe combining character COMBINING CYRILLIC LETTER O' from the Unicode standard, defined by '\x2dea' (╒@Й[).√unicode-tricksThe combining character COMBINING CYRILLIC LETTER PE' from the Unicode standard, defined by '\x2deb' (╒@К[).≈unicode-tricksThe combining character COMBINING CYRILLIC LETTER ER' from the Unicode standard, defined by '\x2dec' (╒@Л[).≤unicode-tricksThe combining character COMBINING CYRILLIC LETTER ES' from the Unicode standard, defined by '\x2ded' (╒@М[).≥unicode-tricksThe combining character COMBINING CYRILLIC LETTER TE' from the Unicode standard, defined by '\x2dee' (╒@Н[). unicode-tricksThe combining character COMBINING CYRILLIC LETTER HA' from the Unicode standard, defined by '\x2def' (╒@О[).⌡unicode-tricksThe combining character COMBINING CYRILLIC LETTER TSE' from the Unicode standard, defined by '\x2df0' (╒@П[).°unicode-tricksThe combining character COMBINING CYRILLIC LETTER CHE' from the Unicode standard, defined by '\x2df1' (╒@Я[).²unicode-tricksThe combining character COMBINING CYRILLIC LETTER SHA' from the Unicode standard, defined by '\x2df2' (╒@Р[).·unicode-tricksThe combining character COMBINING CYRILLIC LETTER SHCHA' from the Unicode standard, defined by '\x2df3' (╒@С[).÷unicode-tricksThe combining character COMBINING CYRILLIC LETTER FITA' from the Unicode standard, defined by '\x2df4' (╒@Т[).═unicode-tricksThe combining character COMBINING CYRILLIC LETTER ES-TE' from the Unicode standard, defined by '\x2df5' (╒@У[).║unicode-tricksThe combining character COMBINING CYRILLIC LETTER A' from the Unicode standard, defined by '\x2df6' (╒@Ж[).╒unicode-tricksThe combining character COMBINING CYRILLIC LETTER IE' from the Unicode standard, defined by '\x2df7' (╒@В[).ёunicode-tricksThe combining character COMBINING CYRILLIC LETTER DJERV' from the Unicode standard, defined by '\x2df8' (╒@Ь[).єunicode-tricksThe combining character &COMBINING CYRILLIC LETTER MONOGRAPH UK' from the Unicode standard, defined by '\x2df9' (╒@Ы[).╔unicode-tricksThe combining character COMBINING CYRILLIC LETTER YAT' from the Unicode standard, defined by '\x2dfa' (╒@З[).іunicode-tricksThe combining character COMBINING CYRILLIC LETTER YU' from the Unicode standard, defined by '\x2dfb' (╒@Ш[).їunicode-tricksThe combining character $COMBINING CYRILLIC LETTER IOTIFIED A' from the Unicode standard, defined by '\x2dfc' (╒@Э[).╗unicode-tricksThe combining character $COMBINING CYRILLIC LETTER LITTLE YUS' from the Unicode standard, defined by '\x2dfd' (╒@Щ[).╘unicode-tricksThe combining character !COMBINING CYRILLIC LETTER BIG YUS' from the Unicode standard, defined by '\x2dfe' (╒@Ч[).╙unicode-tricksThe combining character *COMBINING CYRILLIC LETTER IOTIFIED BIG YUS' from the Unicode standard, defined by '\x2dff' (╒@Ъ[).╚unicode-tricksThe combining character IDEOGRAPHIC LEVEL TONE MARK' from the Unicode standard, defined by '\x302a' (╒@╙`).╛unicode-tricksThe combining character IDEOGRAPHIC RISING TONE MARK' from the Unicode standard, defined by '\x302b' (╒@╚`).ґunicode-tricksThe combining character IDEOGRAPHIC DEPARTING TONE MARK' from the Unicode standard, defined by '\x302c' (╒@╛`).ўunicode-tricksThe combining character IDEOGRAPHIC ENTERING TONE MARK' from the Unicode standard, defined by '\x302d' (╒@ґ`).╞unicode-tricksThe combining character HANGUL SINGLE DOT TONE MARK' from the Unicode standard, defined by '\x302e' (╒@ў`).╟unicode-tricksThe combining character HANGUL DOUBLE DOT TONE MARK' from the Unicode standard, defined by '\x302f' (╒@╞`).╠unicode-tricksThe combining character -COMBINING KATAKANA-HIRAGANA VOICED SOUND MARK' from the Unicode standard, defined by '\x3099' (╒@≥a).╡unicode-tricksThe combining character 2COMBINING KATAKANA-HIRAGANA SEMI-VOICED SOUND MARK' from the Unicode standard, defined by '\x309a' (╒@ a).Ёunicode-tricksThe combining character COMBINING CYRILLIC VZMET' from the Unicode standard, defined by '\xa66f' (╒@Ол).Єunicode-tricksThe combining character &COMBINING CYRILLIC LETTER UKRAINIAN IE' from the Unicode standard, defined by '\xa674' (╒@Тл).╣unicode-tricksThe combining character COMBINING CYRILLIC LETTER I' from the Unicode standard, defined by '\xa675' (╒@Ул).Іunicode-tricksThe combining character COMBINING CYRILLIC LETTER YI' from the Unicode standard, defined by '\xa676' (╒@Жл).Їunicode-tricksThe combining character COMBINING CYRILLIC LETTER U' from the Unicode standard, defined by '\xa677' (╒@Вл).╦unicode-tricksThe combining character #COMBINING CYRILLIC LETTER HARD SIGN' from the Unicode standard, defined by '\xa678' (╒@Ьл).╧unicode-tricksThe combining character COMBINING CYRILLIC LETTER YERU' from the Unicode standard, defined by '\xa679' (╒@Ыл).╨unicode-tricksThe combining character #COMBINING CYRILLIC LETTER SOFT SIGN' from the Unicode standard, defined by '\xa67a' (╒@Зл).╩unicode-tricksThe combining character COMBINING CYRILLIC LETTER OMEGA' from the Unicode standard, defined by '\xa67b' (╒@Шл).╪unicode-tricksThe combining character COMBINING CYRILLIC KAVYKA' from the Unicode standard, defined by '\xa67c' (╒@Эл).Ґunicode-tricksThe combining character COMBINING CYRILLIC PAYEROK' from the Unicode standard, defined by '\xa67d' (╒@Щл).Ўunicode-tricksThe combining character COMBINING CYRILLIC LETTER EF' from the Unicode standard, defined by '\xa69e' (╒@·м).©unicode-tricksThe combining character $COMBINING CYRILLIC LETTER IOTIFIED E' from the Unicode standard, defined by '\xa69f' (╒@÷м).юunicode-tricksThe combining character BAMUM COMBINING MARK KOQNDON' from the Unicode standard, defined by '\xa6f0' (╒@Пм).аunicode-tricksThe combining character BAMUM COMBINING MARK TUKWENTIS' from the Unicode standard, defined by '\xa6f1' (╒@Ям).бunicode-tricksThe combining character SYLOTI NAGRI SIGN HASANTA' from the Unicode standard, defined by '\xa806' (╒@├п).цunicode-tricksThe combining character SAURASHTRA SIGN VIRAMA' from the Unicode standard, defined by '\xa8c4' (╒@дя).дunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT ZERO' from the Unicode standard, defined by '\xa8e0' (╒@Юя).еunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT ONE' from the Unicode standard, defined by '\xa8e1' (╒@Ая).фunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT TWO' from the Unicode standard, defined by '\xa8e2' (╒@Бя).гunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT THREE' from the Unicode standard, defined by '\xa8e3' (╒@Ця).хunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT FOUR' from the Unicode standard, defined by '\xa8e4' (╒@Дя).иunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT FIVE' from the Unicode standard, defined by '\xa8e5' (╒@Ея).йunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT SIX' from the Unicode standard, defined by '\xa8e6' (╒@Фя).кunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT SEVEN' from the Unicode standard, defined by '\xa8e7' (╒@Гя).лunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT EIGHT' from the Unicode standard, defined by '\xa8e8' (╒@Хя).мunicode-tricksThe combining character COMBINING DEVANAGARI DIGIT NINE' from the Unicode standard, defined by '\xa8e9' (╒@Ия).нunicode-tricksThe combining character COMBINING DEVANAGARI LETTER A' from the Unicode standard, defined by '\xa8ea' (╒@Йя).оunicode-tricksThe combining character COMBINING DEVANAGARI LETTER U' from the Unicode standard, defined by '\xa8eb' (╒@Кя).пunicode-tricksThe combining character COMBINING DEVANAGARI LETTER KA' from the Unicode standard, defined by '\xa8ec' (╒@Ля).яunicode-tricksThe combining character COMBINING DEVANAGARI LETTER NA' from the Unicode standard, defined by '\xa8ed' (╒@Мя).рunicode-tricksThe combining character COMBINING DEVANAGARI LETTER PA' from the Unicode standard, defined by '\xa8ee' (╒@Ня).сunicode-tricksThe combining character COMBINING DEVANAGARI LETTER RA' from the Unicode standard, defined by '\xa8ef' (╒@Оя).тunicode-tricksThe combining character COMBINING DEVANAGARI LETTER VI' from the Unicode standard, defined by '\xa8f0' (╒@Пя).уunicode-tricksThe combining character "COMBINING DEVANAGARI SIGN AVAGRAHA' from the Unicode standard, defined by '\xa8f1' (╒@Яя).жunicode-tricksThe combining character KAYAH LI TONE PLOPHU' from the Unicode standard, defined by '\xa92b' (╒@╚р).вunicode-tricksThe combining character KAYAH LI TONE CALYA' from the Unicode standard, defined by '\xa92c' (╒@╛р).ьunicode-tricksThe combining character KAYAH LI TONE CALYA PLOPHU' from the Unicode standard, defined by '\xa92d' (╒@ґр).ыunicode-tricksThe combining character REJANG VIRAMA' from the Unicode standard, defined by '\xa953' (╒@ср).зunicode-tricksThe combining character JAVANESE SIGN CECAK TELU' from the Unicode standard, defined by '\xa9b3' (╒@Ёс).шunicode-tricksThe combining character JAVANESE PANGKON' from the Unicode standard, defined by '\xa9c0' (╒@юс).эunicode-tricksThe combining character TAI VIET MAI KANG' from the Unicode standard, defined by '\xaab0' (╒@╟у).щunicode-tricksThe combining character TAI VIET VOWEL I' from the Unicode standard, defined by '\xaab2' (╒@╡у).чunicode-tricksThe combining character TAI VIET VOWEL UE' from the Unicode standard, defined by '\xaab3' (╒@Ёу).ъunicode-tricksThe combining character TAI VIET VOWEL U' from the Unicode standard, defined by '\xaab4' (╒@Єу).Юunicode-tricksThe combining character TAI VIET MAI KHIT' from the Unicode standard, defined by '\xaab7' (╒@Їу).Аunicode-tricksThe combining character TAI VIET VOWEL IA' from the Unicode standard, defined by '\xaab8' (╒@╦у).Бunicode-tricksThe combining character TAI VIET VOWEL AM' from the Unicode standard, defined by '\xaabe' (╒@Ўу).Цunicode-tricksThe combining character TAI VIET TONE MAI EK' from the Unicode standard, defined by '\xaabf' (╒@©у).Дunicode-tricksThe combining character TAI VIET TONE MAI THO' from the Unicode standard, defined by '\xaac1' (╒@ау).Еunicode-tricksThe combining character MEETEI MAYEK VIRAMA' from the Unicode standard, defined by '\xaaf6' (╒@Жу).Фunicode-tricksThe combining character MEETEI MAYEK APUN IYEK' from the Unicode standard, defined by '\xabed' (╒@Мв).Гunicode-tricksThe combining character !HEBREW POINT JUDEO-SPANISH VARIKA' from the Unicode standard, defined by '\xfb1e' (╒@·Ж).Хunicode-tricksThe combining character COMBINING LIGATURE LEFT HALF' from the Unicode standard, defined by '\xfe20' (╒@═Э).Иunicode-tricksThe combining character COMBINING LIGATURE RIGHT HALF' from the Unicode standard, defined by '\xfe21' (╒@║Э).Йunicode-tricksThe combining character COMBINING DOUBLE TILDE LEFT HALF' from the Unicode standard, defined by '\xfe22' (╒@╒Э).Кunicode-tricksThe combining character !COMBINING DOUBLE TILDE RIGHT HALF' from the Unicode standard, defined by '\xfe23' (╒@ёЭ).Лunicode-tricksThe combining character COMBINING MACRON LEFT HALF' from the Unicode standard, defined by '\xfe24' (╒@єЭ).Мunicode-tricksThe combining character COMBINING MACRON RIGHT HALF' from the Unicode standard, defined by '\xfe25' (╒@╔Э).Нunicode-tricksThe combining character COMBINING CONJOINING MACRON' from the Unicode standard, defined by '\xfe26' (╒@іЭ).Оunicode-tricksThe combining character "COMBINING LIGATURE LEFT HALF BELOW' from the Unicode standard, defined by '\xfe27' (╒@їЭ).Пunicode-tricksThe combining character #COMBINING LIGATURE RIGHT HALF BELOW' from the Unicode standard, defined by '\xfe28' (╒@╗Э).Яunicode-tricksThe combining character COMBINING TILDE LEFT HALF BELOW' from the Unicode standard, defined by '\xfe29' (╒@╘Э).Рunicode-tricksThe combining character COMBINING TILDE RIGHT HALF BELOW' from the Unicode standard, defined by '\xfe2a' (╒@╙Э).Сunicode-tricksThe combining character COMBINING MACRON LEFT HALF BELOW' from the Unicode standard, defined by '\xfe2b' (╒@╚Э).Тunicode-tricksThe combining character !COMBINING MACRON RIGHT HALF BELOW' from the Unicode standard, defined by '\xfe2c' (╒@╛Э).Уunicode-tricksThe combining character !COMBINING CONJOINING MACRON BELOW' from the Unicode standard, defined by '\xfe2d' (╒@ґЭ).Жunicode-tricksThe combining character "COMBINING CYRILLIC TITLO LEFT HALF' from the Unicode standard, defined by '\xfe2e' (╒@ўЭ).Вunicode-tricksThe combining character #COMBINING CYRILLIC TITLO RIGHT HALF' from the Unicode standard, defined by '\xfe2f' (╒@╞Э).Ьunicode-tricksThe combining character +PHAISTOS DISC SIGN COMBINING OBLIQUE STROKE' from the Unicode standard, defined by '\x101fd' (╒@Щ┐).Ыunicode-tricksThe combining character COPTIC EPACT THOUSANDS MARK' from the Unicode standard, defined by '\x102e0' (╒@Ю┘).Зunicode-tricksThe combining character COMBINING OLD PERMIC LETTER AN' from the Unicode standard, defined by '\x10376' (╒@Ж├).Шunicode-tricksThe combining character COMBINING OLD PERMIC LETTER DOI' from the Unicode standard, defined by '\x10377' (╒@В├).Эunicode-tricksThe combining character COMBINING OLD PERMIC LETTER ZATA' from the Unicode standard, defined by '\x10378' (╒@Ь├).Щunicode-tricksThe combining character !COMBINING OLD PERMIC LETTER NENOE' from the Unicode standard, defined by '\x10379' (╒@Ы├).Чunicode-tricksThe combining character COMBINING OLD PERMIC LETTER SII' from the Unicode standard, defined by '\x1037a' (╒@З├).Ъunicode-tricksThe combining character !KHAROSHTHI SIGN DOUBLE RING BELOW' from the Unicode standard, defined by '\x10a0d' (╒@█■).─unicode-tricksThe combining character KHAROSHTHI SIGN VISARGA' from the Unicode standard, defined by '\x10a0f' (╒@▐■).│unicode-tricksThe combining character KHAROSHTHI SIGN BAR ABOVE' from the Unicode standard, defined by '\x10a38' (╒@╦■).┌unicode-tricksThe combining character KHAROSHTHI SIGN CAUDA' from the Unicode standard, defined by '\x10a39' (╒@╧■).┐unicode-tricksThe combining character KHAROSHTHI SIGN DOT BELOW' from the Unicode standard, defined by '\x10a3a' (╒@╨■).└unicode-tricksThe combining character KHAROSHTHI VIRAMA' from the Unicode standard, defined by '\x10a3f' (╒@©■).┘unicode-tricksThe combining character "MANICHAEAN ABBREVIATION MARK ABOVE' from the Unicode standard, defined by '\x10ae5' (╒@Е∙).├unicode-tricksThe combining character "MANICHAEAN ABBREVIATION MARK BELOW' from the Unicode standard, defined by '\x10ae6' (╒@Ф∙).┤unicode-tricksThe combining character BRAHMI VIRAMA' from the Unicode standard, defined by '\x11046' (╒@ф═).┬unicode-tricksThe combining character BRAHMI NUMBER JOINER' from the Unicode standard, defined by '\x1107f' (╒@Ъ═).┴unicode-tricksThe combining character KAITHI SIGN VIRAMA' from the Unicode standard, defined by '\x110b9' (╒@╧║).┼unicode-tricksThe combining character KAITHI SIGN NUKTA' from the Unicode standard, defined by '\x110ba' (╒@╨║).▀unicode-tricksThe combining character CHAKMA SIGN CANDRABINDU' from the Unicode standard, defined by '\x11100' (╒@─╒).▄unicode-tricksThe combining character CHAKMA SIGN ANUSVARA' from the Unicode standard, defined by '\x11101' (╒@│╒).█unicode-tricksThe combining character CHAKMA SIGN VISARGA' from the Unicode standard, defined by '\x11102' (╒@┌╒).▌unicode-tricksThe combining character CHAKMA VOWEL SIGN A' from the Unicode standard, defined by '\x11127' (╒@ї╒).▐unicode-tricksThe combining character CHAKMA VIRAMA' from the Unicode standard, defined by '\x11133' (╒@Ё╒).░unicode-tricksThe combining character CHAKMA MAAYYAA' from the Unicode standard, defined by '\x11134' (╒@Є╒).▒unicode-tricksThe combining character MAHAJANI SIGN NUKTA' from the Unicode standard, defined by '\x11173' (╒@С╒).▓unicode-tricksThe combining character SHARADA SIGN VIRAMA' from the Unicode standard, defined by '\x111c0' (╒@юё).⌠unicode-tricksThe combining character SHARADA SIGN NUKTA' from the Unicode standard, defined by '\x111ca' (╒@йё).■unicode-tricksThe combining character KHOJKI SIGN VIRAMA' from the Unicode standard, defined by '\x11235' (╒@╣є).∙unicode-tricksThe combining character KHOJKI SIGN NUKTA' from the Unicode standard, defined by '\x11236' (╒@Іє).√unicode-tricksThe combining character KHUDAWADI SIGN NUKTA' from the Unicode standard, defined by '\x112e9' (╒@И╔).≈unicode-tricksThe combining character KHUDAWADI SIGN VIRAMA' from the Unicode standard, defined by '\x112ea' (╒@Й╔).≤unicode-tricksThe combining character GRANTHA SIGN NUKTA' from the Unicode standard, defined by '\x1133c' (╒@╪і).≥unicode-tricksThe combining character GRANTHA VOWEL SIGN AA' from the Unicode standard, defined by '\x1133e' (╒@Ўі). unicode-tricksThe combining character GRANTHA SIGN VIRAMA' from the Unicode standard, defined by '\x1134d' (╒@мі).⌡unicode-tricksThe combining character GRANTHA AU LENGTH MARK' from the Unicode standard, defined by '\x11357' (╒@ві).°unicode-tricksThe combining character COMBINING GRANTHA DIGIT ZERO' from the Unicode standard, defined by '\x11366' (╒@Фі).²unicode-tricksThe combining character COMBINING GRANTHA DIGIT ONE' from the Unicode standard, defined by '\x11367' (╒@Гі).·unicode-tricksThe combining character COMBINING GRANTHA DIGIT TWO' from the Unicode standard, defined by '\x11368' (╒@Хі).÷unicode-tricksThe combining character COMBINING GRANTHA DIGIT THREE' from the Unicode standard, defined by '\x11369' (╒@Иі).═unicode-tricksThe combining character COMBINING GRANTHA DIGIT FOUR' from the Unicode standard, defined by '\x1136a' (╒@Йі).║unicode-tricksThe combining character COMBINING GRANTHA DIGIT FIVE' from the Unicode standard, defined by '\x1136b' (╒@Кі).╒unicode-tricksThe combining character COMBINING GRANTHA DIGIT SIX' from the Unicode standard, defined by '\x1136c' (╒@Лі).ёunicode-tricksThe combining character COMBINING GRANTHA LETTER A' from the Unicode standard, defined by '\x11370' (╒@Пі).єunicode-tricksThe combining character COMBINING GRANTHA LETTER KA' from the Unicode standard, defined by '\x11371' (╒@Яі).╔unicode-tricksThe combining character COMBINING GRANTHA LETTER NA' from the Unicode standard, defined by '\x11372' (╒@Рі).іunicode-tricksThe combining character COMBINING GRANTHA LETTER VI' from the Unicode standard, defined by '\x11373' (╒@Сі).їunicode-tricksThe combining character COMBINING GRANTHA LETTER PA' from the Unicode standard, defined by '\x11374' (╒@Ті).╗unicode-tricksThe combining character NEWA SIGN VIRAMA' from the Unicode standard, defined by '\x11442' (╒@б╗).╘unicode-tricksThe combining character NEWA SIGN NUKTA' from the Unicode standard, defined by '\x11446' (╒@ф╗).╙unicode-tricksThe combining character TIRHUTA VOWEL SIGN AA' from the Unicode standard, defined by '\x114b0' (╒@╟╘).╚unicode-tricksThe combining character TIRHUTA VOWEL SIGN SHORT E' from the Unicode standard, defined by '\x114ba' (╒@╨╘).╛unicode-tricksThe combining character TIRHUTA VOWEL SIGN SHORT O' from the Unicode standard, defined by '\x114bd' (╒@Ґ╘).ґunicode-tricksThe combining character TIRHUTA SIGN VIRAMA' from the Unicode standard, defined by '\x114c2' (╒@б╘).ўunicode-tricksThe combining character TIRHUTA SIGN NUKTA' from the Unicode standard, defined by '\x114c3' (╒@ц╘).╞unicode-tricksThe combining character SIDDHAM VOWEL SIGN AA' from the Unicode standard, defined by '\x115af' (╒@╞╚).╟unicode-tricksThe combining character SIDDHAM SIGN VIRAMA' from the Unicode standard, defined by '\x115bf' (╒@©╚).╠unicode-tricksThe combining character SIDDHAM SIGN NUKTA' from the Unicode standard, defined by '\x115c0' (╒@ю╚).╡unicode-tricksThe combining character MODI SIGN VIRAMA' from the Unicode standard, defined by '\x1163f' (╒@©╛).Ёunicode-tricksThe combining character TAKRI SIGN VIRAMA' from the Unicode standard, defined by '\x116b6' (╒@Іґ).Єunicode-tricksThe combining character TAKRI SIGN NUKTA' from the Unicode standard, defined by '\x116b7' (╒@Їґ).╣unicode-tricksThe combining character AHOM SIGN KILLER' from the Unicode standard, defined by '\x1172b' (╒@╚ў).Іunicode-tricksThe combining character BHAIKSUKI SIGN VIRAMA' from the Unicode standard, defined by '\x11c3f' (╒@©╦).Їunicode-tricksThe combining character BASSA VAH COMBINING HIGH TONE' from the Unicode standard, defined by '\x16af0' (╒@Пу).╦unicode-tricksThe combining character BASSA VAH COMBINING LOW TONE' from the Unicode standard, defined by '\x16af1' (╒@Яу).╧unicode-tricksThe combining character BASSA VAH COMBINING MID TONE' from the Unicode standard, defined by '\x16af2' (╒@Ру).╨unicode-tricksThe combining character BASSA VAH COMBINING LOW-MID TONE' from the Unicode standard, defined by '\x16af3' (╒@Су).╩unicode-tricksThe combining character !BASSA VAH COMBINING HIGH-LOW TONE' from the Unicode standard, defined by '\x16af4' (╒@Ту).╪unicode-tricksThe combining character PAHAWH HMONG MARK CIM TUB' from the Unicode standard, defined by '\x16b30' (╒@╟ж).Ґunicode-tricksThe combining character PAHAWH HMONG MARK CIM SO' from the Unicode standard, defined by '\x16b31' (╒@╠ж).Ўunicode-tricksThe combining character PAHAWH HMONG MARK CIM KES' from the Unicode standard, defined by '\x16b32' (╒@╡ж).©unicode-tricksThe combining character PAHAWH HMONG MARK CIM KHAV' from the Unicode standard, defined by '\x16b33' (╒@Ёж).юunicode-tricksThe combining character PAHAWH HMONG MARK CIM SUAM' from the Unicode standard, defined by '\x16b34' (╒@Єж).аunicode-tricksThe combining character PAHAWH HMONG MARK CIM HOM' from the Unicode standard, defined by '\x16b35' (╒@╣ж).бunicode-tricksThe combining character PAHAWH HMONG MARK CIM TAUM' from the Unicode standard, defined by '\x16b36' (╒@Іж).цunicode-tricksThe combining character DUPLOYAN DOUBLE MARK' from the Unicode standard, defined by '\x1bc9e' (╒@·Ы).дunicode-tricksThe combining character MUSICAL SYMBOL COMBINING STEM' from the Unicode standard, defined by '\x1d165' (╒@Е╒).еunicode-tricksThe combining character *MUSICAL SYMBOL COMBINING SPRECHGESANG STEM' from the Unicode standard, defined by '\x1d166' (╒@Ф╒).фunicode-tricksThe combining character "MUSICAL SYMBOL COMBINING TREMOLO-1' from the Unicode standard, defined by '\x1d167' (╒@Г╒).гunicode-tricksThe combining character "MUSICAL SYMBOL COMBINING TREMOLO-2' from the Unicode standard, defined by '\x1d168' (╒@Х╒).хunicode-tricksThe combining character "MUSICAL SYMBOL COMBINING TREMOLO-3' from the Unicode standard, defined by '\x1d169' (╒@И╒).иunicode-tricksThe combining character )MUSICAL SYMBOL COMBINING AUGMENTATION DOT' from the Unicode standard, defined by '\x1d16d' (╒@М╒).йunicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-1' from the Unicode standard, defined by '\x1d16e' (╒@Н╒).кunicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-2' from the Unicode standard, defined by '\x1d16f' (╒@О╒).лunicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-3' from the Unicode standard, defined by '\x1d170' (╒@П╒).мunicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-4' from the Unicode standard, defined by '\x1d171' (╒@Я╒).нunicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLAG-5' from the Unicode standard, defined by '\x1d172' (╒@Р╒).оunicode-tricksThe combining character MUSICAL SYMBOL COMBINING ACCENT' from the Unicode standard, defined by '\x1d17b' (╒@Ш╒).пunicode-tricksThe combining character !MUSICAL SYMBOL COMBINING STACCATO' from the Unicode standard, defined by '\x1d17c' (╒@Э╒).яunicode-tricksThe combining character MUSICAL SYMBOL COMBINING TENUTO' from the Unicode standard, defined by '\x1d17d' (╒@Щ╒).рunicode-tricksThe combining character &MUSICAL SYMBOL COMBINING STACCATISSIMO' from the Unicode standard, defined by '\x1d17e' (╒@Ч╒).сunicode-tricksThe combining character MUSICAL SYMBOL COMBINING MARCATO' from the Unicode standard, defined by '\x1d17f' (╒@Ъ╒).тunicode-tricksThe combining character )MUSICAL SYMBOL COMBINING MARCATO-STACCATO' from the Unicode standard, defined by '\x1d180' (╒@─ё).уunicode-tricksThe combining character (MUSICAL SYMBOL COMBINING ACCENT-STACCATO' from the Unicode standard, defined by '\x1d181' (╒@│ё).жunicode-tricksThe combining character MUSICAL SYMBOL COMBINING LOURE' from the Unicode standard, defined by '\x1d182' (╒@┌ё).вunicode-tricksThe combining character MUSICAL SYMBOL COMBINING DOIT' from the Unicode standard, defined by '\x1d185' (╒@┘ё).ьunicode-tricksThe combining character MUSICAL SYMBOL COMBINING RIP' from the Unicode standard, defined by '\x1d186' (╒@├ё).ыunicode-tricksThe combining character MUSICAL SYMBOL COMBINING FLIP' from the Unicode standard, defined by '\x1d187' (╒@┤ё).зunicode-tricksThe combining character MUSICAL SYMBOL COMBINING SMEAR' from the Unicode standard, defined by '\x1d188' (╒@┬ё).шunicode-tricksThe combining character MUSICAL SYMBOL COMBINING BEND' from the Unicode standard, defined by '\x1d189' (╒@┴ё).эunicode-tricksThe combining character &MUSICAL SYMBOL COMBINING DOUBLE TONGUE' from the Unicode standard, defined by '\x1d18a' (╒@┼ё).щunicode-tricksThe combining character &MUSICAL SYMBOL COMBINING TRIPLE TONGUE' from the Unicode standard, defined by '\x1d18b' (╒@▀ё).чunicode-tricksThe combining character !MUSICAL SYMBOL COMBINING DOWN BOW' from the Unicode standard, defined by '\x1d1aa' (╒@╙ё).ъunicode-tricksThe combining character MUSICAL SYMBOL COMBINING UP BOW' from the Unicode standard, defined by '\x1d1ab' (╒@╚ё).Юunicode-tricksThe combining character !MUSICAL SYMBOL COMBINING HARMONIC' from the Unicode standard, defined by '\x1d1ac' (╒@╛ё).Аunicode-tricksThe combining character 'MUSICAL SYMBOL COMBINING SNAP PIZZICATO' from the Unicode standard, defined by '\x1d1ad' (╒@ґё).Бunicode-tricksThe combining character COMBINING GREEK MUSICAL TRISEME' from the Unicode standard, defined by '\x1d242' (╒@бє).Цunicode-tricksThe combining character !COMBINING GREEK MUSICAL TETRASEME' from the Unicode standard, defined by '\x1d243' (╒@цє).Дunicode-tricksThe combining character !COMBINING GREEK MUSICAL PENTASEME' from the Unicode standard, defined by '\x1d244' (╒@дє).Еunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER AZU' from the Unicode standard, defined by '\x1e000' (╒@─ю).Фunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER BUKY' from the Unicode standard, defined by '\x1e001' (╒@│ю).Гunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER VEDE' from the Unicode standard, defined by '\x1e002' (╒@┌ю).Хunicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER GLAGOLI' from the Unicode standard, defined by '\x1e003' (╒@┐ю).Иunicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER DOBRO' from the Unicode standard, defined by '\x1e004' (╒@└ю).Йunicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER YESTU' from the Unicode standard, defined by '\x1e005' (╒@┘ю).Кunicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER ZHIVETE' from the Unicode standard, defined by '\x1e006' (╒@├ю).Лunicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER ZEMLJA' from the Unicode standard, defined by '\x1e008' (╒@┬ю).Мunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER IZHE' from the Unicode standard, defined by '\x1e009' (╒@┴ю).Нunicode-tricksThe combining character (COMBINING GLAGOLITIC LETTER INITIAL IZHE' from the Unicode standard, defined by '\x1e00a' (╒@┼ю).Оunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER I' from the Unicode standard, defined by '\x1e00b' (╒@▀ю).Пunicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER DJERVI' from the Unicode standard, defined by '\x1e00c' (╒@▄ю).Яunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER KAKO' from the Unicode standard, defined by '\x1e00d' (╒@█ю).Рunicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER LJUDIJE' from the Unicode standard, defined by '\x1e00e' (╒@▌ю).Сunicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER MYSLITE' from the Unicode standard, defined by '\x1e00f' (╒@▐ю).Тunicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER NASHI' from the Unicode standard, defined by '\x1e010' (╒@░ю).Уunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER ONU' from the Unicode standard, defined by '\x1e011' (╒@▒ю).Жunicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER POKOJI' from the Unicode standard, defined by '\x1e012' (╒@▓ю).Вunicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER RITSI' from the Unicode standard, defined by '\x1e013' (╒@⌠ю).Ьunicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER SLOVO' from the Unicode standard, defined by '\x1e014' (╒@■ю).Ыunicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER TVRIDO' from the Unicode standard, defined by '\x1e015' (╒@∙ю).Зunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER UKU' from the Unicode standard, defined by '\x1e016' (╒@√ю).Шunicode-tricksThe combining character !COMBINING GLAGOLITIC LETTER FRITU' from the Unicode standard, defined by '\x1e017' (╒@≈ю).Эunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER HERU' from the Unicode standard, defined by '\x1e018' (╒@≤ю).Щunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER SHTA' from the Unicode standard, defined by '\x1e01b' (╒@⌡ю).Чunicode-tricksThe combining character COMBINING GLAGOLITIC LETTER TSI' from the Unicode standard, defined by '\x1e01c' (╒@°ю).Ъunicode-tricksThe combining character "COMBINING GLAGOLITIC LETTER CHRIVI' from the Unicode standard, defined by '\x1e01d' (╒@²ю).─unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER SHA' from the Unicode standard, defined by '\x1e01e' (╒@·ю).│unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YERU' from the Unicode standard, defined by '\x1e01f' (╒@÷ю).┌unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YERI' from the Unicode standard, defined by '\x1e020' (╒@═ю).┐unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YATI' from the Unicode standard, defined by '\x1e021' (╒@║ю).└unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YU' from the Unicode standard, defined by '\x1e023' (╒@ёю).┘unicode-tricksThe combining character %COMBINING GLAGOLITIC LETTER SMALL YUS' from the Unicode standard, defined by '\x1e024' (╒@єю).├unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER YO' from the Unicode standard, defined by '\x1e026' (╒@ію).┤unicode-tricksThe combining character -COMBINING GLAGOLITIC LETTER IOTATED SMALL YUS' from the Unicode standard, defined by '\x1e027' (╒@їю).┬unicode-tricksThe combining character #COMBINING GLAGOLITIC LETTER BIG YUS' from the Unicode standard, defined by '\x1e028' (╒@╗ю).┴unicode-tricksThe combining character +COMBINING GLAGOLITIC LETTER IOTATED BIG YUS' from the Unicode standard, defined by '\x1e029' (╒@╘ю).┼unicode-tricksThe combining character COMBINING GLAGOLITIC LETTER FITA' from the Unicode standard, defined by '\x1e02a' (╒@╙ю).▀unicode-tricksThe combining character $MENDE KIKAKUI COMBINING NUMBER TEENS' from the Unicode standard, defined by '\x1e8d0' (╒@пя).▄unicode-tricksThe combining character #MENDE KIKAKUI COMBINING NUMBER TENS' from the Unicode standard, defined by '\x1e8d1' (╒@яя).█unicode-tricksThe combining character 'MENDE KIKAKUI COMBINING NUMBER HUNDREDS' from the Unicode standard, defined by '\x1e8d2' (╒@ря).▌unicode-tricksThe combining character (MENDE KIKAKUI COMBINING NUMBER THOUSANDS' from the Unicode standard, defined by '\x1e8d3' (╒@ся).▐unicode-tricksThe combining character ,MENDE KIKAKUI COMBINING NUMBER TEN THOUSANDS' from the Unicode standard, defined by '\x1e8d4' (╒@тя).░unicode-tricksThe combining character 0MENDE KIKAKUI COMBINING NUMBER HUNDRED THOUSANDS' from the Unicode standard, defined by '\x1e8d5' (╒@уя).▒unicode-tricksThe combining character 'MENDE KIKAKUI COMBINING NUMBER MILLIONS' from the Unicode standard, defined by '\x1e8d6' (╒@жя).▓unicode-tricksThe combining character ADLAM ALIF LENGTHENER' from the Unicode standard, defined by '\x1e944' (╒@др).⌠unicode-tricksThe combining character ADLAM VOWEL LENGTHENER' from the Unicode standard, defined by '\x1e945' (╒@ер).■unicode-tricksThe combining character ADLAM GEMINATION MARK' from the Unicode standard, defined by '\x1e946' (╒@фр).∙unicode-tricksThe combining character ADLAM HAMZA' from the Unicode standard, defined by '\x1e947' (╒@гр).√unicode-tricksThe combining character ADLAM CONSONANT MODIFIER' from the Unicode standard, defined by '\x1e948' (╒@хр).≈unicode-tricksThe combining character !ADLAM GEMINATE CONSONANT MODIFIER' from the Unicode standard, defined by '\x1e949' (╒@ир).≤unicode-tricksThe combining character ADLAM NUKTA' from the Unicode standard, defined by '\x1e94a' (╒@йр).≥unicode-tricksA pattern synonym for ▒, the name without the Combining part, defined by '\x1e8d6' (╒@жя). unicode-tricksA pattern synonym for ░, the name without the Combining part, defined by '\x1e8d5' (╒@уя).⌡unicode-tricksA pattern synonym for ▐, the name without the Combining part, defined by '\x1e8d4' (╒@тя).°unicode-tricksA pattern synonym for ▌, the name without the Combining part, defined by '\x1e8d3' (╒@ся).²unicode-tricksA pattern synonym for █, the name without the Combining part, defined by '\x1e8d2' (╒@ря).·unicode-tricksA pattern synonym for ▄, the name without the Combining part, defined by '\x1e8d1' (╒@яя).÷unicode-tricksA pattern synonym for ▀, the name without the Combining part, defined by '\x1e8d0' (╒@пя).═unicode-tricksA pattern synonym for ┼, the name without the Combining part, defined by '\x1e02a' (╒@╙ю).║unicode-tricksA pattern synonym for ┴, the name without the Combining part, defined by '\x1e029' (╒@╘ю).╒unicode-tricksA pattern synonym for ┬, the name without the Combining part, defined by '\x1e028' (╒@╗ю).ёunicode-tricksA pattern synonym for ┤, the name without the Combining part, defined by '\x1e027' (╒@їю).єunicode-tricksA pattern synonym for ├, the name without the Combining part, defined by '\x1e026' (╒@ію).╔unicode-tricksA pattern synonym for ┘, the name without the Combining part, defined by '\x1e024' (╒@єю).іunicode-tricksA pattern synonym for └, the name without the Combining part, defined by '\x1e023' (╒@ёю).їunicode-tricksA pattern synonym for ┐, the name without the Combining part, defined by '\x1e021' (╒@║ю).╗unicode-tricksA pattern synonym for ┌, the name without the Combining part, defined by '\x1e020' (╒@═ю).╘unicode-tricksA pattern synonym for │, the name without the Combining part, defined by '\x1e01f' (╒@÷ю).╙unicode-tricksA pattern synonym for ─, the name without the Combining part, defined by '\x1e01e' (╒@·ю).╚unicode-tricksA pattern synonym for Ъ, the name without the Combining part, defined by '\x1e01d' (╒@²ю).╛unicode-tricksA pattern synonym for Ч, the name without the Combining part, defined by '\x1e01c' (╒@°ю).ґunicode-tricksA pattern synonym for Щ, the name without the Combining part, defined by '\x1e01b' (╒@⌡ю).ўunicode-tricksA pattern synonym for Э, the name without the Combining part, defined by '\x1e018' (╒@≤ю).╞unicode-tricksA pattern synonym for Ш, the name without the Combining part, defined by '\x1e017' (╒@≈ю).╟unicode-tricksA pattern synonym for З, the name without the Combining part, defined by '\x1e016' (╒@√ю).╠unicode-tricksA pattern synonym for Ы, the name without the Combining part, defined by '\x1e015' (╒@∙ю).╡unicode-tricksA pattern synonym for Ь, the name without the Combining part, defined by '\x1e014' (╒@■ю).Ёunicode-tricksA pattern synonym for В, the name without the Combining part, defined by '\x1e013' (╒@⌠ю).Єunicode-tricksA pattern synonym for Ж, the name without the Combining part, defined by '\x1e012' (╒@▓ю).╣unicode-tricksA pattern synonym for У, the name without the Combining part, defined by '\x1e011' (╒@▒ю).Іunicode-tricksA pattern synonym for Т, the name without the Combining part, defined by '\x1e010' (╒@░ю).Їunicode-tricksA pattern synonym for С, the name without the Combining part, defined by '\x1e00f' (╒@▐ю).╦unicode-tricksA pattern synonym for Р, the name without the Combining part, defined by '\x1e00e' (╒@▌ю).╧unicode-tricksA pattern synonym for Я, the name without the Combining part, defined by '\x1e00d' (╒@█ю).╨unicode-tricksA pattern synonym for П, the name without the Combining part, defined by '\x1e00c' (╒@▄ю).╩unicode-tricksA pattern synonym for О, the name without the Combining part, defined by '\x1e00b' (╒@▀ю).╪unicode-tricksA pattern synonym for Н, the name without the Combining part, defined by '\x1e00a' (╒@┼ю).Ґunicode-tricksA pattern synonym for М, the name without the Combining part, defined by '\x1e009' (╒@┴ю).Ўunicode-tricksA pattern synonym for Л, the name without the Combining part, defined by '\x1e008' (╒@┬ю).©unicode-tricksA pattern synonym for К, the name without the Combining part, defined by '\x1e006' (╒@├ю).юunicode-tricksA pattern synonym for Й, the name without the Combining part, defined by '\x1e005' (╒@┘ю).аunicode-tricksA pattern synonym for И, the name without the Combining part, defined by '\x1e004' (╒@└ю).бunicode-tricksA pattern synonym for Х, the name without the Combining part, defined by '\x1e003' (╒@┐ю).цunicode-tricksA pattern synonym for Г, the name without the Combining part, defined by '\x1e002' (╒@┌ю).дunicode-tricksA pattern synonym for Ф, the name without the Combining part, defined by '\x1e001' (╒@│ю).еunicode-tricksA pattern synonym for Е, the name without the Combining part, defined by '\x1e000' (╒@─ю).фunicode-tricksA pattern synonym for Д, the name without the Combining part, defined by '\x1d244' (╒@дє).гunicode-tricksA pattern synonym for Ц, the name without the Combining part, defined by '\x1d243' (╒@цє).хunicode-tricksA pattern synonym for Б, the name without the Combining part, defined by '\x1d242' (╒@бє).иunicode-tricksA pattern synonym for А, the name without the Combining part, defined by '\x1d1ad' (╒@ґё).йunicode-tricksA pattern synonym for Ю, the name without the Combining part, defined by '\x1d1ac' (╒@╛ё).кunicode-tricksA pattern synonym for ъ, the name without the Combining part, defined by '\x1d1ab' (╒@╚ё).лunicode-tricksA pattern synonym for ч, the name without the Combining part, defined by '\x1d1aa' (╒@╙ё).мunicode-tricksA pattern synonym for щ, the name without the Combining part, defined by '\x1d18b' (╒@▀ё).нunicode-tricksA pattern synonym for э, the name without the Combining part, defined by '\x1d18a' (╒@┼ё).оunicode-tricksA pattern synonym for ш, the name without the Combining part, defined by '\x1d189' (╒@┴ё).пunicode-tricksA pattern synonym for з, the name without the Combining part, defined by '\x1d188' (╒@┬ё).яunicode-tricksA pattern synonym for ы, the name without the Combining part, defined by '\x1d187' (╒@┤ё).рunicode-tricksA pattern synonym for ь, the name without the Combining part, defined by '\x1d186' (╒@├ё).сunicode-tricksA pattern synonym for в, the name without the Combining part, defined by '\x1d185' (╒@┘ё).тunicode-tricksA pattern synonym for ж, the name without the Combining part, defined by '\x1d182' (╒@┌ё).уunicode-tricksA pattern synonym for у, the name without the Combining part, defined by '\x1d181' (╒@│ё).жunicode-tricksA pattern synonym for т, the name without the Combining part, defined by '\x1d180' (╒@─ё).вunicode-tricksA pattern synonym for с, the name without the Combining part, defined by '\x1d17f' (╒@Ъ╒).ьunicode-tricksA pattern synonym for р, the name without the Combining part, defined by '\x1d17e' (╒@Ч╒).ыunicode-tricksA pattern synonym for я, the name without the Combining part, defined by '\x1d17d' (╒@Щ╒).зunicode-tricksA pattern synonym for п, the name without the Combining part, defined by '\x1d17c' (╒@Э╒).шunicode-tricksA pattern synonym for о, the name without the Combining part, defined by '\x1d17b' (╒@Ш╒).эunicode-tricksA pattern synonym for н, the name without the Combining part, defined by '\x1d172' (╒@Р╒).щunicode-tricksA pattern synonym for м, the name without the Combining part, defined by '\x1d171' (╒@Я╒).чunicode-tricksA pattern synonym for л, the name without the Combining part, defined by '\x1d170' (╒@П╒).ъunicode-tricksA pattern synonym for к, the name without the Combining part, defined by '\x1d16f' (╒@О╒).Юunicode-tricksA pattern synonym for й, the name without the Combining part, defined by '\x1d16e' (╒@Н╒).Аunicode-tricksA pattern synonym for и, the name without the Combining part, defined by '\x1d16d' (╒@М╒).Бunicode-tricksA pattern synonym for х, the name without the Combining part, defined by '\x1d169' (╒@И╒).Цunicode-tricksA pattern synonym for г, the name without the Combining part, defined by '\x1d168' (╒@Х╒).Дunicode-tricksA pattern synonym for ф, the name without the Combining part, defined by '\x1d167' (╒@Г╒).Еunicode-tricksA pattern synonym for е, the name without the Combining part, defined by '\x1d166' (╒@Ф╒).Фunicode-tricksA pattern synonym for д, the name without the Combining part, defined by '\x1d165' (╒@Е╒).Гunicode-tricksA pattern synonym for ╩, the name without the Combining part, defined by '\x16af4' (╒@Ту).Хunicode-tricksA pattern synonym for ╨, the name without the Combining part, defined by '\x16af3' (╒@Су).Иunicode-tricksA pattern synonym for ╧, the name without the Combining part, defined by '\x16af2' (╒@Ру).Йunicode-tricksA pattern synonym for ╦, the name without the Combining part, defined by '\x16af1' (╒@Яу).Кunicode-tricksA pattern synonym for Ї, the name without the Combining part, defined by '\x16af0' (╒@Пу).Лunicode-tricksA pattern synonym for ї, the name without the Combining part, defined by '\x11374' (╒@Ті).Мunicode-tricksA pattern synonym for і, the name without the Combining part, defined by '\x11373' (╒@Сі).Нunicode-tricksA pattern synonym for ╔, the name without the Combining part, defined by '\x11372' (╒@Рі).Оunicode-tricksA pattern synonym for є, the name without the Combining part, defined by '\x11371' (╒@Яі).Пunicode-tricksA pattern synonym for ё, the name without the Combining part, defined by '\x11370' (╒@Пі).Яunicode-tricksA pattern synonym for ╒, the name without the Combining part, defined by '\x1136c' (╒@Лі).Рunicode-tricksA pattern synonym for ║, the name without the Combining part, defined by '\x1136b' (╒@Кі).Сunicode-tricksA pattern synonym for ═, the name without the Combining part, defined by '\x1136a' (╒@Йі).Тunicode-tricksA pattern synonym for ÷, the name without the Combining part, defined by '\x11369' (╒@Иі).Уunicode-tricksA pattern synonym for ·, the name without the Combining part, defined by '\x11368' (╒@Хі).Жunicode-tricksA pattern synonym for ², the name without the Combining part, defined by '\x11367' (╒@Гі).Вunicode-tricksA pattern synonym for °, the name without the Combining part, defined by '\x11366' (╒@Фі).Ьunicode-tricksA pattern synonym for Ч, the name without the Combining part, defined by '\x1037a' (╒@З├).Ыunicode-tricksA pattern synonym for Щ, the name without the Combining part, defined by '\x10379' (╒@Ы├).Зunicode-tricksA pattern synonym for Э, the name without the Combining part, defined by '\x10378' (╒@Ь├).Шunicode-tricksA pattern synonym for Ш, the name without the Combining part, defined by '\x10377' (╒@В├).Эunicode-tricksA pattern synonym for З, the name without the Combining part, defined by '\x10376' (╒@Ж├).Щunicode-tricksA pattern synonym for Ь, the name without the Combining part, defined by '\x101fd' (╒@Щ┐).Чunicode-tricksA pattern synonym for В, the name without the Combining part, defined by '\xfe2f' (╒@╞Э).Ъunicode-tricksA pattern synonym for Ж, the name without the Combining part, defined by '\xfe2e' (╒@ўЭ).─ unicode-tricksA pattern synonym for У, the name without the Combining part, defined by '\xfe2d' (╒@ґЭ).│ unicode-tricksA pattern synonym for Т, the name without the Combining part, defined by '\xfe2c' (╒@╛Э).┌ unicode-tricksA pattern synonym for С, the name without the Combining part, defined by '\xfe2b' (╒@╚Э).┐ unicode-tricksA pattern synonym for Р, the name without the Combining part, defined by '\xfe2a' (╒@╙Э).└ unicode-tricksA pattern synonym for Я, the name without the Combining part, defined by '\xfe29' (╒@╘Э).┘ unicode-tricksA pattern synonym for П, the name without the Combining part, defined by '\xfe28' (╒@╗Э).├ unicode-tricksA pattern synonym for О, the name without the Combining part, defined by '\xfe27' (╒@їЭ).┤ unicode-tricksA pattern synonym for Н, the name without the Combining part, defined by '\xfe26' (╒@іЭ).┬ unicode-tricksA pattern synonym for М, the name without the Combining part, defined by '\xfe25' (╒@╔Э).┴ unicode-tricksA pattern synonym for Л, the name without the Combining part, defined by '\xfe24' (╒@єЭ).┼ unicode-tricksA pattern synonym for К, the name without the Combining part, defined by '\xfe23' (╒@ёЭ).▀ unicode-tricksA pattern synonym for Й, the name without the Combining part, defined by '\xfe22' (╒@╒Э).▄ unicode-tricksA pattern synonym for И, the name without the Combining part, defined by '\xfe21' (╒@║Э).█ unicode-tricksA pattern synonym for Х, the name without the Combining part, defined by '\xfe20' (╒@═Э).▌ unicode-tricksA pattern synonym for у, the name without the Combining part, defined by '\xa8f1' (╒@Яя).▐ unicode-tricksA pattern synonym for т, the name without the Combining part, defined by '\xa8f0' (╒@Пя).░ unicode-tricksA pattern synonym for с, the name without the Combining part, defined by '\xa8ef' (╒@Оя).▒ unicode-tricksA pattern synonym for р, the name without the Combining part, defined by '\xa8ee' (╒@Ня).▓ unicode-tricksA pattern synonym for я, the name without the Combining part, defined by '\xa8ed' (╒@Мя).⌠ unicode-tricksA pattern synonym for п, the name without the Combining part, defined by '\xa8ec' (╒@Ля).■ unicode-tricksA pattern synonym for о, the name without the Combining part, defined by '\xa8eb' (╒@Кя).∙ unicode-tricksA pattern synonym for н, the name without the Combining part, defined by '\xa8ea' (╒@Йя).√ unicode-tricksA pattern synonym for м, the name without the Combining part, defined by '\xa8e9' (╒@Ия).≈ unicode-tricksA pattern synonym for л, the name without the Combining part, defined by '\xa8e8' (╒@Хя).≤ unicode-tricksA pattern synonym for к, the name without the Combining part, defined by '\xa8e7' (╒@Гя).≥ unicode-tricksA pattern synonym for й, the name without the Combining part, defined by '\xa8e6' (╒@Фя). unicode-tricksA pattern synonym for и, the name without the Combining part, defined by '\xa8e5' (╒@Ея).⌡ unicode-tricksA pattern synonym for х, the name without the Combining part, defined by '\xa8e4' (╒@Дя).° unicode-tricksA pattern synonym for г, the name without the Combining part, defined by '\xa8e3' (╒@Ця).² unicode-tricksA pattern synonym for ф, the name without the Combining part, defined by '\xa8e2' (╒@Бя).· unicode-tricksA pattern synonym for е, the name without the Combining part, defined by '\xa8e1' (╒@Ая).÷ unicode-tricksA pattern synonym for д, the name without the Combining part, defined by '\xa8e0' (╒@Юя).═ unicode-tricksA pattern synonym for а, the name without the Combining part, defined by '\xa6f1' (╒@Ям).║ unicode-tricksA pattern synonym for ю, the name without the Combining part, defined by '\xa6f0' (╒@Пм).╒ unicode-tricksA pattern synonym for ©, the name without the Combining part, defined by '\xa69f' (╒@÷м).ё unicode-tricksA pattern synonym for Ў, the name without the Combining part, defined by '\xa69e' (╒@·м).є unicode-tricksA pattern synonym for Ґ, the name without the Combining part, defined by '\xa67d' (╒@Щл).╔ unicode-tricksA pattern synonym for ╪, the name without the Combining part, defined by '\xa67c' (╒@Эл).і unicode-tricksA pattern synonym for ╩, the name without the Combining part, defined by '\xa67b' (╒@Шл).ї unicode-tricksA pattern synonym for ╨, the name without the Combining part, defined by '\xa67a' (╒@Зл).╗ unicode-tricksA pattern synonym for ╧, the name without the Combining part, defined by '\xa679' (╒@Ыл).╘ unicode-tricksA pattern synonym for ╦, the name without the Combining part, defined by '\xa678' (╒@Ьл).╙ unicode-tricksA pattern synonym for Ї, the name without the Combining part, defined by '\xa677' (╒@Вл).╚ unicode-tricksA pattern synonym for І, the name without the Combining part, defined by '\xa676' (╒@Жл).╛ unicode-tricksA pattern synonym for ╣, the name without the Combining part, defined by '\xa675' (╒@Ул).ґ unicode-tricksA pattern synonym for Є, the name without the Combining part, defined by '\xa674' (╒@Тл).ў unicode-tricksA pattern synonym for Ё, the name without the Combining part, defined by '\xa66f' (╒@Ол).╞ unicode-tricksA pattern synonym for ╡, the name without the Combining part, defined by '\x309a' (╒@ a).╟ unicode-tricksA pattern synonym for ╠, the name without the Combining part, defined by '\x3099' (╒@≥a).╠ unicode-tricksA pattern synonym for ╙, the name without the Combining part, defined by '\x2dff' (╒@Ъ[).╡ unicode-tricksA pattern synonym for ╘, the name without the Combining part, defined by '\x2dfe' (╒@Ч[).Ё unicode-tricksA pattern synonym for ╗, the name without the Combining part, defined by '\x2dfd' (╒@Щ[).Є unicode-tricksA pattern synonym for ї, the name without the Combining part, defined by '\x2dfc' (╒@Э[).╣ unicode-tricksA pattern synonym for і, the name without the Combining part, defined by '\x2dfb' (╒@Ш[).І unicode-tricksA pattern synonym for ╔, the name without the Combining part, defined by '\x2dfa' (╒@З[).Ї unicode-tricksA pattern synonym for є, the name without the Combining part, defined by '\x2df9' (╒@Ы[).╦ unicode-tricksA pattern synonym for ё, the name without the Combining part, defined by '\x2df8' (╒@Ь[).╧ unicode-tricksA pattern synonym for ╒, the name without the Combining part, defined by '\x2df7' (╒@В[).╨ unicode-tricksA pattern synonym for ║, the name without the Combining part, defined by '\x2df6' (╒@Ж[).╩ unicode-tricksA pattern synonym for ═, the name without the Combining part, defined by '\x2df5' (╒@У[).╪ unicode-tricksA pattern synonym for ÷, the name without the Combining part, defined by '\x2df4' (╒@Т[).Ґ unicode-tricksA pattern synonym for ·, the name without the Combining part, defined by '\x2df3' (╒@С[).Ў unicode-tricksA pattern synonym for ², the name without the Combining part, defined by '\x2df2' (╒@Р[).© unicode-tricksA pattern synonym for °, the name without the Combining part, defined by '\x2df1' (╒@Я[).ю unicode-tricksA pattern synonym for ⌡, the name without the Combining part, defined by '\x2df0' (╒@П[).а unicode-tricksA pattern synonym for , the name without the Combining part, defined by '\x2def' (╒@О[).б unicode-tricksA pattern synonym for ≥, the name without the Combining part, defined by '\x2dee' (╒@Н[).ц unicode-tricksA pattern synonym for ≤, the name without the Combining part, defined by '\x2ded' (╒@М[).д unicode-tricksA pattern synonym for ≈, the name without the Combining part, defined by '\x2dec' (╒@Л[).е unicode-tricksA pattern synonym for √, the name without the Combining part, defined by '\x2deb' (╒@К[).ф unicode-tricksA pattern synonym for ∙, the name without the Combining part, defined by '\x2dea' (╒@Й[).г unicode-tricksA pattern synonym for ■, the name without the Combining part, defined by '\x2de9' (╒@И[).х unicode-tricksA pattern synonym for ⌠, the name without the Combining part, defined by '\x2de8' (╒@Х[).и unicode-tricksA pattern synonym for ▓, the name without the Combining part, defined by '\x2de7' (╒@Г[).й unicode-tricksA pattern synonym for ▒, the name without the Combining part, defined by '\x2de6' (╒@Ф[).к unicode-tricksA pattern synonym for ░, the name without the Combining part, defined by '\x2de5' (╒@Е[).л unicode-tricksA pattern synonym for ▐, the name without the Combining part, defined by '\x2de4' (╒@Д[).м unicode-tricksA pattern synonym for ▌, the name without the Combining part, defined by '\x2de3' (╒@Ц[).н unicode-tricksA pattern synonym for █, the name without the Combining part, defined by '\x2de2' (╒@Б[).о unicode-tricksA pattern synonym for ▄, the name without the Combining part, defined by '\x2de1' (╒@А[).п unicode-tricksA pattern synonym for ▀, the name without the Combining part, defined by '\x2de0' (╒@Ю[).я unicode-tricksA pattern synonym for ┴, the name without the Combining part, defined by '\x2cf1' (╒@ЯY).р unicode-tricksA pattern synonym for ┬, the name without the Combining part, defined by '\x2cf0' (╒@ПY).с unicode-tricksA pattern synonym for ┤, the name without the Combining part, defined by '\x2cef' (╒@ОY).т unicode-tricksA pattern synonym for ├, the name without the Combining part, defined by '\x20f0' (╒@ПA).у unicode-tricksA pattern synonym for ┘, the name without the Combining part, defined by '\x20ef' (╒@ОA).ж unicode-tricksA pattern synonym for └, the name without the Combining part, defined by '\x20ee' (╒@НA).в unicode-tricksA pattern synonym for ┐, the name without the Combining part, defined by '\x20ed' (╒@МA).ь unicode-tricksA pattern synonym for ┌, the name without the Combining part, defined by '\x20ec' (╒@ЛA).ы unicode-tricksA pattern synonym for │, the name without the Combining part, defined by '\x20eb' (╒@КA).з unicode-tricksA pattern synonym for ─, the name without the Combining part, defined by '\x20ea' (╒@ЙA).ш unicode-tricksA pattern synonym for Ъ, the name without the Combining part, defined by '\x20e9' (╒@ИA).э unicode-tricksA pattern synonym for Ч, the name without the Combining part, defined by '\x20e8' (╒@ХA).щ unicode-tricksA pattern synonym for Щ, the name without the Combining part, defined by '\x20e7' (╒@ГA).ч unicode-tricksA pattern synonym for Э, the name without the Combining part, defined by '\x20e6' (╒@ФA).ъ unicode-tricksA pattern synonym for Ш, the name without the Combining part, defined by '\x20e5' (╒@ЕA).Ю unicode-tricksA pattern synonym for З, the name without the Combining part, defined by '\x20e1' (╒@АA).А unicode-tricksA pattern synonym for Ы, the name without the Combining part, defined by '\x20dc' (╒@эA).Б unicode-tricksA pattern synonym for Ь, the name without the Combining part, defined by '\x20db' (╒@шA).Ц unicode-tricksA pattern synonym for В, the name without the Combining part, defined by '\x20da' (╒@зA).Д unicode-tricksA pattern synonym for Ж, the name without the Combining part, defined by '\x20d9' (╒@ыA).Е unicode-tricksA pattern synonym for У, the name without the Combining part, defined by '\x20d8' (╒@ьA).Ф unicode-tricksA pattern synonym for Т, the name without the Combining part, defined by '\x20d7' (╒@вA).Г unicode-tricksA pattern synonym for С, the name without the Combining part, defined by '\x20d6' (╒@жA).Х unicode-tricksA pattern synonym for Р, the name without the Combining part, defined by '\x20d5' (╒@уA).И unicode-tricksA pattern synonym for Я, the name without the Combining part, defined by '\x20d4' (╒@тA).Й unicode-tricksA pattern synonym for П, the name without the Combining part, defined by '\x20d3' (╒@сA).К unicode-tricksA pattern synonym for О, the name without the Combining part, defined by '\x20d2' (╒@рA).Л unicode-tricksA pattern synonym for Н, the name without the Combining part, defined by '\x20d1' (╒@яA).М unicode-tricksA pattern synonym for М, the name without the Combining part, defined by '\x20d0' (╒@пA).Н unicode-tricksA pattern synonym for Л, the name without the Combining part, defined by '\x1dff' (╒@Ъ;).О unicode-tricksA pattern synonym for К, the name without the Combining part, defined by '\x1dfe' (╒@Ч;).П unicode-tricksA pattern synonym for Й, the name without the Combining part, defined by '\x1dfd' (╒@Щ;).Я unicode-tricksA pattern synonym for И, the name without the Combining part, defined by '\x1dfc' (╒@Э;).Р unicode-tricksA pattern synonym for Х, the name without the Combining part, defined by '\x1dfb' (╒@Ш;).С unicode-tricksA pattern synonym for Г, the name without the Combining part, defined by '\x1df5' (╒@У;).Т unicode-tricksA pattern synonym for Ф, the name without the Combining part, defined by '\x1df4' (╒@Т;).У unicode-tricksA pattern synonym for Е, the name without the Combining part, defined by '\x1df3' (╒@С;).Ж unicode-tricksA pattern synonym for Д, the name without the Combining part, defined by '\x1df2' (╒@Р;).В unicode-tricksA pattern synonym for Ц, the name without the Combining part, defined by '\x1df1' (╒@Я;).Ь unicode-tricksA pattern synonym for Б, the name without the Combining part, defined by '\x1df0' (╒@П;).Ы unicode-tricksA pattern synonym for А, the name without the Combining part, defined by '\x1def' (╒@О;).З unicode-tricksA pattern synonym for Ю, the name without the Combining part, defined by '\x1dee' (╒@Н;).Ш unicode-tricksA pattern synonym for ъ, the name without the Combining part, defined by '\x1ded' (╒@М;).Э unicode-tricksA pattern synonym for ч, the name without the Combining part, defined by '\x1dec' (╒@Л;).Щ unicode-tricksA pattern synonym for щ, the name without the Combining part, defined by '\x1deb' (╒@К;).Ч unicode-tricksA pattern synonym for э, the name without the Combining part, defined by '\x1dea' (╒@Й;).Ъ unicode-tricksA pattern synonym for ш, the name without the Combining part, defined by '\x1de9' (╒@И;).─ unicode-tricksA pattern synonym for з, the name without the Combining part, defined by '\x1de8' (╒@Х;).│ unicode-tricksA pattern synonym for ы, the name without the Combining part, defined by '\x1de7' (╒@Г;).┌ unicode-tricksA pattern synonym for ь, the name without the Combining part, defined by '\x1de6' (╒@Ф;).┐ unicode-tricksA pattern synonym for в, the name without the Combining part, defined by '\x1de5' (╒@Е;).└ unicode-tricksA pattern synonym for ж, the name without the Combining part, defined by '\x1de4' (╒@Д;).┘ unicode-tricksA pattern synonym for у, the name without the Combining part, defined by '\x1de3' (╒@Ц;).├ unicode-tricksA pattern synonym for т, the name without the Combining part, defined by '\x1de2' (╒@Б;).┤ unicode-tricksA pattern synonym for с, the name without the Combining part, defined by '\x1de1' (╒@А;).┬ unicode-tricksA pattern synonym for р, the name without the Combining part, defined by '\x1de0' (╒@Ю;).┴ unicode-tricksA pattern synonym for я, the name without the Combining part, defined by '\x1ddf' (╒@ъ;).┼ unicode-tricksA pattern synonym for п, the name without the Combining part, defined by '\x1dde' (╒@ч;).▀ unicode-tricksA pattern synonym for о, the name without the Combining part, defined by '\x1ddd' (╒@щ;).▄ unicode-tricksA pattern synonym for н, the name without the Combining part, defined by '\x1ddc' (╒@э;).█ unicode-tricksA pattern synonym for м, the name without the Combining part, defined by '\x1ddb' (╒@ш;).▌ unicode-tricksA pattern synonym for л, the name without the Combining part, defined by '\x1dda' (╒@з;).▐ unicode-tricksA pattern synonym for к, the name without the Combining part, defined by '\x1dd9' (╒@ы;).░ unicode-tricksA pattern synonym for й, the name without the Combining part, defined by '\x1dd8' (╒@ь;).▒ unicode-tricksA pattern synonym for и, the name without the Combining part, defined by '\x1dd7' (╒@в;).▓ unicode-tricksA pattern synonym for х, the name without the Combining part, defined by '\x1dd6' (╒@ж;).⌠ unicode-tricksA pattern synonym for г, the name without the Combining part, defined by '\x1dd5' (╒@у;).■ unicode-tricksA pattern synonym for ф, the name without the Combining part, defined by '\x1dd4' (╒@т;).∙ unicode-tricksA pattern synonym for е, the name without the Combining part, defined by '\x1dd3' (╒@с;).√ unicode-tricksA pattern synonym for д, the name without the Combining part, defined by '\x1dd2' (╒@р;).≈ unicode-tricksA pattern synonym for ц, the name without the Combining part, defined by '\x1dd1' (╒@я;).≤ unicode-tricksA pattern synonym for б, the name without the Combining part, defined by '\x1dd0' (╒@п;).≥ unicode-tricksA pattern synonym for а, the name without the Combining part, defined by '\x1dcf' (╒@о;). unicode-tricksA pattern synonym for ю, the name without the Combining part, defined by '\x1dce' (╒@н;).⌡ unicode-tricksA pattern synonym for ©, the name without the Combining part, defined by '\x1dcd' (╒@м;).° unicode-tricksA pattern synonym for Ў, the name without the Combining part, defined by '\x1dcc' (╒@л;).² unicode-tricksA pattern synonym for Ґ, the name without the Combining part, defined by '\x1dcb' (╒@к;).· unicode-tricksA pattern synonym for ╪, the name without the Combining part, defined by '\x1dca' (╒@й;).÷ unicode-tricksA pattern synonym for ╩, the name without the Combining part, defined by '\x1dc9' (╒@и;).═ unicode-tricksA pattern synonym for ╨, the name without the Combining part, defined by '\x1dc8' (╒@х;).║ unicode-tricksA pattern synonym for ╧, the name without the Combining part, defined by '\x1dc7' (╒@г;).╒ unicode-tricksA pattern synonym for ╦, the name without the Combining part, defined by '\x1dc6' (╒@ф;).ё unicode-tricksA pattern synonym for Ї, the name without the Combining part, defined by '\x1dc5' (╒@е;).є unicode-tricksA pattern synonym for І, the name without the Combining part, defined by '\x1dc4' (╒@д;).╔ unicode-tricksA pattern synonym for ╣, the name without the Combining part, defined by '\x1dc3' (╒@ц;).і unicode-tricksA pattern synonym for Є, the name without the Combining part, defined by '\x1dc2' (╒@б;).ї unicode-tricksA pattern synonym for Ё, the name without the Combining part, defined by '\x1dc1' (╒@а;).╗ unicode-tricksA pattern synonym for ╡, the name without the Combining part, defined by '\x1dc0' (╒@ю;).╘ unicode-tricksA pattern synonym for ░, the name without the Combining part, defined by '\x1b73' (╒@С6).╙ unicode-tricksA pattern synonym for ▐, the name without the Combining part, defined by '\x1b72' (╒@Р6).╚ unicode-tricksA pattern synonym for ▌, the name without the Combining part, defined by '\x1b71' (╒@Я6).╛ unicode-tricksA pattern synonym for █, the name without the Combining part, defined by '\x1b70' (╒@П6).ґ unicode-tricksA pattern synonym for ▄, the name without the Combining part, defined by '\x1b6f' (╒@О6).ў unicode-tricksA pattern synonym for ▀, the name without the Combining part, defined by '\x1b6e' (╒@Н6).╞ unicode-tricksA pattern synonym for ┼, the name without the Combining part, defined by '\x1b6d' (╒@М6).╟ unicode-tricksA pattern synonym for ┴, the name without the Combining part, defined by '\x1b6c' (╒@Л6).╠ unicode-tricksA pattern synonym for ┬, the name without the Combining part, defined by '\x1b6b' (╒@К6).╡ unicode-tricksA pattern synonym for └, the name without the Combining part, defined by '\x1abd' (╒@Ґ5).Ё unicode-tricksA pattern synonym for ┐, the name without the Combining part, defined by '\x1abc' (╒@╪5).Є unicode-tricksA pattern synonym for ┌, the name without the Combining part, defined by '\x1abb' (╒@╩5).╣ unicode-tricksA pattern synonym for │, the name without the Combining part, defined by '\x1aba' (╒@╨5).І unicode-tricksA pattern synonym for ─, the name without the Combining part, defined by '\x1ab9' (╒@╧5).Ї unicode-tricksA pattern synonym for Ъ, the name without the Combining part, defined by '\x1ab8' (╒@╦5).╦ unicode-tricksA pattern synonym for Ч, the name without the Combining part, defined by '\x1ab7' (╒@Ї5).╧ unicode-tricksA pattern synonym for Щ, the name without the Combining part, defined by '\x1ab6' (╒@І5).╨ unicode-tricksA pattern synonym for Э, the name without the Combining part, defined by '\x1ab5' (╒@╣5).╩ unicode-tricksA pattern synonym for Ш, the name without the Combining part, defined by '\x1ab4' (╒@Є5).╪ unicode-tricksA pattern synonym for З, the name without the Combining part, defined by '\x1ab3' (╒@Ё5).Ґ unicode-tricksA pattern synonym for Ы, the name without the Combining part, defined by '\x1ab2' (╒@╡5).Ў unicode-tricksA pattern synonym for Ь, the name without the Combining part, defined by '\x1ab1' (╒@╠5).© unicode-tricksA pattern synonym for В, the name without the Combining part, defined by '\x1ab0' (╒@╟5).ю unicode-tricksA pattern synonym for Ж, the name without the Combining part, defined by '\x1a7f' (╒@Ъ4).а unicode-tricksA pattern synonym for Б, the name without the Combining part, defined by '\x135f' (╒@ъ&).б unicode-tricksA pattern synonym for А, the name without the Combining part, defined by '\x135e' (╒@ч&).ц unicode-tricksA pattern synonym for Ю, the name without the Combining part, defined by '\x135d' (╒@щ&).д unicode-tricksA pattern synonym for я, the name without the Combining part, defined by '\x07f3' (╒@С).е unicode-tricksA pattern synonym for п, the name without the Combining part, defined by '\x07f2' (╒@Р).ф unicode-tricksA pattern synonym for о, the name without the Combining part, defined by '\x07f1' (╒@Я).г unicode-tricksA pattern synonym for н, the name without the Combining part, defined by '\x07f0' (╒@П).х unicode-tricksA pattern synonym for м, the name without the Combining part, defined by '\x07ef' (╒@О).и unicode-tricksA pattern synonym for л, the name without the Combining part, defined by '\x07ee' (╒@Н).й unicode-tricksA pattern synonym for к, the name without the Combining part, defined by '\x07ed' (╒@М).к unicode-tricksA pattern synonym for й, the name without the Combining part, defined by '\x07ec' (╒@Л).л unicode-tricksA pattern synonym for и, the name without the Combining part, defined by '\x07eb' (╒@К).м unicode-tricksA pattern synonym for е, the name without the Combining part, defined by '\x0487' (╒@┤ ).н unicode-tricksA pattern synonym for д, the name without the Combining part, defined by '\x0486' (╒@├ ).о unicode-tricksA pattern synonym for ц, the name without the Combining part, defined by '\x0485' (╒@┘ ).п unicode-tricksA pattern synonym for б, the name without the Combining part, defined by '\x0484' (╒@└ ).я unicode-tricksA pattern synonym for а, the name without the Combining part, defined by '\x0483' (╒@┐ ).р unicode-tricksA pattern synonym for ю, the name without the Combining part, defined by '\x036f' (╒@О).с unicode-tricksA pattern synonym for ©, the name without the Combining part, defined by '\x036e' (╒@Н).т unicode-tricksA pattern synonym for Ў, the name without the Combining part, defined by '\x036d' (╒@М).у unicode-tricksA pattern synonym for Ґ, the name without the Combining part, defined by '\x036c' (╒@Л).ж unicode-tricksA pattern synonym for ╪, the name without the Combining part, defined by '\x036b' (╒@К).в unicode-tricksA pattern synonym for ╩, the name without the Combining part, defined by '\x036a' (╒@Й).ь unicode-tricksA pattern synonym for ╨, the name without the Combining part, defined by '\x0369' (╒@И).ы unicode-tricksA pattern synonym for ╧, the name without the Combining part, defined by '\x0368' (╒@Х).з unicode-tricksA pattern synonym for ╦, the name without the Combining part, defined by '\x0367' (╒@Г).ш unicode-tricksA pattern synonym for Ї, the name without the Combining part, defined by '\x0366' (╒@Ф).э unicode-tricksA pattern synonym for І, the name without the Combining part, defined by '\x0365' (╒@Е).щ unicode-tricksA pattern synonym for ╣, the name without the Combining part, defined by '\x0364' (╒@Д).ч unicode-tricksA pattern synonym for Є, the name without the Combining part, defined by '\x0363' (╒@Ц).ъ unicode-tricksA pattern synonym for Ё, the name without the Combining part, defined by '\x0362' (╒@Б).Ю unicode-tricksA pattern synonym for ╡, the name without the Combining part, defined by '\x0361' (╒@А).А unicode-tricksA pattern synonym for ╠, the name without the Combining part, defined by '\x0360' (╒@Ю).Б unicode-tricksA pattern synonym for ╟, the name without the Combining part, defined by '\x035f' (╒@ъ).Ц unicode-tricksA pattern synonym for ╞, the name without the Combining part, defined by '\x035e' (╒@ч).Д unicode-tricksA pattern synonym for ў, the name without the Combining part, defined by '\x035d' (╒@щ).Е unicode-tricksA pattern synonym for ґ, the name without the Combining part, defined by '\x035c' (╒@э).Ф unicode-tricksA pattern synonym for ╛, the name without the Combining part, defined by '\x035b' (╒@ш).Г unicode-tricksA pattern synonym for ╚, the name without the Combining part, defined by '\x035a' (╒@з).Х unicode-tricksA pattern synonym for ╙, the name without the Combining part, defined by '\x0359' (╒@ы).И unicode-tricksA pattern synonym for ╘, the name without the Combining part, defined by '\x0358' (╒@ь).Й unicode-tricksA pattern synonym for ╗, the name without the Combining part, defined by '\x0357' (╒@в).К unicode-tricksA pattern synonym for ї, the name without the Combining part, defined by '\x0356' (╒@ж).Л unicode-tricksA pattern synonym for і, the name without the Combining part, defined by '\x0355' (╒@у).М unicode-tricksA pattern synonym for ╔, the name without the Combining part, defined by '\x0354' (╒@т).Н unicode-tricksA pattern synonym for є, the name without the Combining part, defined by '\x0353' (╒@с).О unicode-tricksA pattern synonym for ё, the name without the Combining part, defined by '\x0352' (╒@р).П unicode-tricksA pattern synonym for ╒, the name without the Combining part, defined by '\x0351' (╒@я).Я unicode-tricksA pattern synonym for ║, the name without the Combining part, defined by '\x0350' (╒@п).Р unicode-tricksA pattern synonym for ═, the name without the Combining part, defined by '\x034e' (╒@н).С unicode-tricksA pattern synonym for ÷, the name without the Combining part, defined by '\x034d' (╒@м).Т unicode-tricksA pattern synonym for ·, the name without the Combining part, defined by '\x034c' (╒@л).У unicode-tricksA pattern synonym for ², the name without the Combining part, defined by '\x034b' (╒@к).Ж unicode-tricksA pattern synonym for °, the name without the Combining part, defined by '\x034a' (╒@й).В unicode-tricksA pattern synonym for ⌡, the name without the Combining part, defined by '\x0349' (╒@и).Ь unicode-tricksA pattern synonym for , the name without the Combining part, defined by '\x0348' (╒@х).Ы unicode-tricksA pattern synonym for ≥, the name without the Combining part, defined by '\x0347' (╒@г).З unicode-tricksA pattern synonym for ≤, the name without the Combining part, defined by '\x0346' (╒@ф).Ш unicode-tricksA pattern synonym for ≈, the name without the Combining part, defined by '\x0345' (╒@е).Э unicode-tricksA pattern synonym for √, the name without the Combining part, defined by '\x0344' (╒@д).Щ unicode-tricksA pattern synonym for ∙, the name without the Combining part, defined by '\x0343' (╒@ц).Ч unicode-tricksA pattern synonym for ■, the name without the Combining part, defined by '\x0342' (╒@б).Ъ unicode-tricksA pattern synonym for ⌠, the name without the Combining part, defined by '\x0341' (╒@а).─unicode-tricksA pattern synonym for ▓, the name without the Combining part, defined by '\x0340' (╒@ю).│unicode-tricksA pattern synonym for ▒, the name without the Combining part, defined by '\x033f' (╒@©).┌unicode-tricksA pattern synonym for ░, the name without the Combining part, defined by '\x033e' (╒@Ў).┐unicode-tricksA pattern synonym for ▐, the name without the Combining part, defined by '\x033d' (╒@Ґ).└unicode-tricksA pattern synonym for ▌, the name without the Combining part, defined by '\x033c' (╒@╪).┘unicode-tricksA pattern synonym for █, the name without the Combining part, defined by '\x033b' (╒@╩).├unicode-tricksA pattern synonym for ▄, the name without the Combining part, defined by '\x033a' (╒@╨).┤unicode-tricksA pattern synonym for ▀, the name without the Combining part, defined by '\x0339' (╒@╧).┬unicode-tricksA pattern synonym for ┼, the name without the Combining part, defined by '\x0338' (╒@╦).┴unicode-tricksA pattern synonym for ┴, the name without the Combining part, defined by '\x0337' (╒@Ї).┼unicode-tricksA pattern synonym for ┬, the name without the Combining part, defined by '\x0336' (╒@І).▀unicode-tricksA pattern synonym for ┤, the name without the Combining part, defined by '\x0335' (╒@╣).▄unicode-tricksA pattern synonym for ├, the name without the Combining part, defined by '\x0334' (╒@Є).█unicode-tricksA pattern synonym for ┘, the name without the Combining part, defined by '\x0333' (╒@Ё).▌unicode-tricksA pattern synonym for └, the name without the Combining part, defined by '\x0332' (╒@╡).▐unicode-tricksA pattern synonym for ┐, the name without the Combining part, defined by '\x0331' (╒@╠).░unicode-tricksA pattern synonym for ┌, the name without the Combining part, defined by '\x0330' (╒@╟).▒unicode-tricksA pattern synonym for │, the name without the Combining part, defined by '\x032f' (╒@╞).▓unicode-tricksA pattern synonym for ─, the name without the Combining part, defined by '\x032e' (╒@ў).⌠unicode-tricksA pattern synonym for Ъ, the name without the Combining part, defined by '\x032d' (╒@ґ).■unicode-tricksA pattern synonym for Ч, the name without the Combining part, defined by '\x032c' (╒@╛).∙unicode-tricksA pattern synonym for Щ, the name without the Combining part, defined by '\x032b' (╒@╚).√unicode-tricksA pattern synonym for Э, the name without the Combining part, defined by '\x032a' (╒@╙).≈unicode-tricksA pattern synonym for Ш, the name without the Combining part, defined by '\x0329' (╒@╘).≤unicode-tricksA pattern synonym for З, the name without the Combining part, defined by '\x0328' (╒@╗).≥unicode-tricksA pattern synonym for Ы, the name without the Combining part, defined by '\x0327' (╒@ї). unicode-tricksA pattern synonym for Ь, the name without the Combining part, defined by '\x0326' (╒@і).⌡unicode-tricksA pattern synonym for В, the name without the Combining part, defined by '\x0325' (╒@╔).°unicode-tricksA pattern synonym for Ж, the name without the Combining part, defined by '\x0324' (╒@є).²unicode-tricksA pattern synonym for У, the name without the Combining part, defined by '\x0323' (╒@ё).·unicode-tricksA pattern synonym for Т, the name without the Combining part, defined by '\x0322' (╒@╒).÷unicode-tricksA pattern synonym for С, the name without the Combining part, defined by '\x0321' (╒@║).═unicode-tricksA pattern synonym for Р, the name without the Combining part, defined by '\x0320' (╒@═).║unicode-tricksA pattern synonym for Я, the name without the Combining part, defined by '\x031f' (╒@÷).╒unicode-tricksA pattern synonym for П, the name without the Combining part, defined by '\x031e' (╒@·).ёunicode-tricksA pattern synonym for О, the name without the Combining part, defined by '\x031d' (╒@²).єunicode-tricksA pattern synonym for Н, the name without the Combining part, defined by '\x031c' (╒@°).╔unicode-tricksA pattern synonym for М, the name without the Combining part, defined by '\x031b' (╒@⌡).іunicode-tricksA pattern synonym for Л, the name without the Combining part, defined by '\x031a' (╒@ ).їunicode-tricksA pattern synonym for К, the name without the Combining part, defined by '\x0319' (╒@≥).╗unicode-tricksA pattern synonym for Й, the name without the Combining part, defined by '\x0318' (╒@≤).╘unicode-tricksA pattern synonym for И, the name without the Combining part, defined by '\x0317' (╒@≈).╙unicode-tricksA pattern synonym for Х, the name without the Combining part, defined by '\x0316' (╒@√).╚unicode-tricksA pattern synonym for Г, the name without the Combining part, defined by '\x0315' (╒@∙).╛unicode-tricksA pattern synonym for Ф, the name without the Combining part, defined by '\x0314' (╒@■).ґunicode-tricksA pattern synonym for Е, the name without the Combining part, defined by '\x0313' (╒@⌠).ўunicode-tricksA pattern synonym for Д, the name without the Combining part, defined by '\x0312' (╒@▓).╞unicode-tricksA pattern synonym for Ц, the name without the Combining part, defined by '\x0311' (╒@▒).╟unicode-tricksA pattern synonym for Б, the name without the Combining part, defined by '\x0310' (╒@░).╠unicode-tricksA pattern synonym for А, the name without the Combining part, defined by '\x030f' (╒@▐).╡unicode-tricksA pattern synonym for Ю, the name without the Combining part, defined by '\x030e' (╒@▌).Ёunicode-tricksA pattern synonym for ъ, the name without the Combining part, defined by '\x030d' (╒@█).Єunicode-tricksA pattern synonym for ч, the name without the Combining part, defined by '\x030c' (╒@▄).╣unicode-tricksA pattern synonym for щ, the name without the Combining part, defined by '\x030b' (╒@▀).Іunicode-tricksA pattern synonym for э, the name without the Combining part, defined by '\x030a' (╒@┼).Їunicode-tricksA pattern synonym for ш, the name without the Combining part, defined by '\x0309' (╒@┴).╦unicode-tricksA pattern synonym for з, the name without the Combining part, defined by '\x0308' (╒@┬).╧unicode-tricksA pattern synonym for ы, the name without the Combining part, defined by '\x0307' (╒@┤).╨unicode-tricksA pattern synonym for ь, the name without the Combining part, defined by '\x0306' (╒@├).╩unicode-tricksA pattern synonym for в, the name without the Combining part, defined by '\x0305' (╒@┘).╪unicode-tricksA pattern synonym for ж, the name without the Combining part, defined by '\x0304' (╒@└).Ґunicode-tricksA pattern synonym for у, the name without the Combining part, defined by '\x0303' (╒@┐).Ўunicode-tricksA pattern synonym for т, the name without the Combining part, defined by '\x0302' (╒@┌).©unicode-tricksA pattern synonym for с, the name without the Combining part, defined by '\x0301' (╒@│).юunicode-tricksA pattern synonym for р, the name without the Combining part, defined by '\x0300' (╒@─).аunicode-tricksConvert the given я to a уй in Unicode, this codepoints need a preceding codepoint to be applied to.бunicode-tricksChecks if the given у is a combining character.цunicode-tricksConvert the given у to its corresponding я. If the given у is not a combining! character, an error is produced.дunicode-tricksConvert the given у to its corresponding я wrapped in a в data constructor. If the given у is not a combining character, ь is returned.еunicode-tricksConvert the given уеacter to a 2-tuple that contains the "root" character, and a set of я▐s that can be applied to construct that character. Characters that do not contain a combining character return an empty list for the list of яs.For a у that is a яэ itself, it will return a 2-tuple with that character as first item, and an empty list of яs.фunicode-tricksConvert the given у:acter to its "root" character that omits all the applied яs. If the given уacter is a я itself, then this is returned.гunicode-tricksRemove the я s in the ш┤ and the ones that are applied to a character through "composition". This function is useful for example to remove diacritics from a ш object.хunicode-tricks4Convert a given character that can be represented a у and a я= to a 2-tuple that contains this combination. The returning уЩ (the first item in the 2-tuple) can still be a composed form, and thus can sometimes be passed again through this function.иunicode-tricks,Try to combine the given character with the яs in the list, by applying кл on the items left-to-right. The result is a 2-tuple with a more dedicated у$acter (if possible), and a list of я;s that could not be applied. This is a flipped version of й.йunicode-tricks,Try to combine the given character with the яs in the list, by applying кл on the items left-to-right. The result is a 2-tuple with a more dedicated у$acter (if possible), and a list of я;s that could not be applied. This is a flipped version of и.кunicode-tricksCheck if for the given у and the given я a dedicated уя exists that is the equivalent. If so, that dedicated character is wrapped in a в; ь* otherwise. This is a flipped version of л.лunicode-tricksCheck if for the given у and the given я a dedicated уя exists that is the equivalent. If so, that dedicated character is wrapped in a в; ь* otherwise. This is a flipped version of к.аunicode-tricks The given я# to convert to a Unicode codepoint.unicode-tricks A Unicode у)acter that is the codepoint of the given я. Theбunicode-tricks The given уacter to check.unicode-tricksы if the given у acter is a combining character; з otherwise.цunicode-tricks The given у to convert.unicode-tricksThe corresponding я if such character exists.дunicode-tricks The given у to convert to a я.unicode-tricksThe equivalent я for the given у wrapped in a в ; if the у is not a combining character, ь.еunicode-tricksThe уacter to decompose.unicode-tricksA 2-tuple with the "root" уacter and the list of яs that are applied to it.фunicode-tricksThe у/acter that should be stripped from its applied яs.unicode-tricksThe "root" уacter that is the given у acter stripped from the applied яs.гunicode-tricks The given ш object to strip я/s from, both through filtering and decomposing.unicode-tricksA ш object where the яs are filtered out.хunicode-tricks The given уacter to decompose.unicode-tricksA 2-tuple of a уacter and a я wrapped in a в if the у can be decomposed; ь otherwise.иunicode-tricks The given уacter to start with.unicode-tricksThe list of яs to apply.йunicode-tricksThe list of яs to apply.unicode-tricks The given уacter to start with.кunicode-tricks The given уacter that is combined with a я.unicode-tricks The given я that is applied to the given уacter.unicode-tricksA dedicated уacter wrapped in a в if such character exists, ь otherwise.лunicode-tricks The given я that is applied to the given уacter.unicode-tricks The given уacter that is combined with a я.unicode-tricksA dedicated уacter wrapped in a в if such character exists, ь otherwise.┌ клмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийкл┌ ярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤пноадцбфгклмхеклийю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─Ъ Ч Щ Э Ш З Ы Ь В Ж У Т С Р Я П О Н М Л К Й И Х Г Ф Е Д Ц Б А Ю ъ ч щ э ш з ы ь в ж у т с р я п о н м л к й и х г ф е д ц б а ю © Ў Ґ ╪ ╩ ╨ ╧ ╦ Ї І ╣ Є Ё ╡ ╠ ╟ ╞ ў ґ ╛ ╚ ╙ ╘ ╗ ї і ╔ є ё ╒ ║ ═ ÷ · ² ° ⌡ ≥ ≤ ≈ √ ∙ ■ ⌠ ▓ ▒ ░ ▐ ▌ █ ▄ ▀ ┼ ┴ ┬ ┤ ├ ┘ └ ┐ ┌ │ ─ Ъ Ч Щ Э Ш З Ы Ь В Ж У Т С Р Я П О Н М Л К Й И Х Г Ф Е Д Ц Б А Ю ъ ч щ э ш з ы ь в ж у т с р я п о н м л к й и х г ф е д ц б а ю © Ў Ґ ╪ ╩ ╨ ╧ ╦ Ї І ╣ Є Ё ╡ ╠ ╟ ╞ ў ґ ╛ ╚ ╙ ╘ ╗ ї і ╔ є ё ╒ ║ ═ ÷ · ² ° ⌡ ≥ ≤ ≈ √ ∙ ■ ⌠ ▓ ▒ ░ ▐ ▌ █ ▄ ▀ ┼ ┴ ┬ ┤ ├ ┘ └ ┐ ┌ │ ─ ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥л8м8(Support for chess characters in unicode.hapytexeu+gh@gmail.comexperimentalPOSIXSafeХ⌠(Дunicode-tricks?Chess pieces that can be represented in Unicode. These are the king, queen, rook, bishop, knight, pawn, and equihopper, over 0, 90, 180, and 270 degrees; and the knight over 45, 135, 225, and 315 degrees in Ш, З and Э. Furthermore one can draw a knight-queen, knight-rook, and knight-bishop3 pieces can be drawn without rotation and only in Ъ or Ч.Еunicode-tricksStandard pieces drawn in black, white, or neutral and with rotation.Фunicode-tricksKnights6 have unicode characters to render these rotated over 45, 135, 225 and 315 degrees.Гunicode-tricks,Hybrid chess pieces can only be rendered in Ъ and Ч.Хunicode-tricksHybrid chess pieces like the knight-queen, knight-rook and knight-bishop.Иunicode-tricksThe knight-queen chess piece.Йunicode-tricksThe knight-rook chess piece.Кunicode-tricksThe knight-bishop chess piece.Лunicode-tricks>Extra rotations that can be performed for knight chess pieces.Мunicode-tricksRotation over 45 degrees.Нunicode-tricksRotation over 135 degrees.Оunicode-tricksRotation over 225 degrees.Пunicode-tricksRotation over 315 degrees.Яunicode-tricks.The type of chess pieces. Unicode includes an Ь as piece as well.Рunicode-tricksThe king chess piece.Сunicode-tricksThe queen chess piece.Тunicode-tricksThe rook chess piece.Уunicode-tricksThe bishop chess piece.Жunicode-tricksThe knight chess piece.Вunicode-tricksThe pawn chess piece.Ьunicode-tricksThe equihopper chess piece.Ыunicode-tricks8The color of a chess piece, this can for most pieces be Ш, З, or Э.Зunicode-tricksWhite color.Шunicode-tricksBlack color.Эunicode-tricks.Neutral chess pieces, sometimes depicted half white and half black.Щunicode-tricks(A data type that defined binary colors (Ч, and Ъ1), this is used for special chess pieces like a knight queen, knight rook, and knight bishop, that only have no neutral color in unicode.Чunicode-tricksWhite color.Ъunicode-tricksBlack color.─unicode-tricksA princess is alterative name for a knight-bishop.│unicode-tricksA cardinal is alterative name for a knight-bishop.┌unicode-tricksAn empress is alterative name for a knight-rook.┐unicode-tricksA marshall is alterative name for a knight-rook.└unicode-tricksA chancellor is alterative name for a knight-rook.┘unicode-tricksA superqueen is alterative name for a knight-queen.├unicode-tricksAn omnipotent queen is alterative name for a knight-queen.┤unicode-tricksA terror is alterative name for a knight-queen.┬unicode-tricksAn amazon is alterative name for a knight-queen.┴unicode-tricksA Nightrider is a knight rotated over 180 degrees.┼unicode-tricksA grasshopper is a queen rotated over 180 degrees.▀unicode-tricksConvert the given Д( to the corresponding unicode character.▀unicode-tricks The given Д to convert.unicode-tricks0The unicode character that represents the given Д.(ДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀(ЫЗШЭЩЧЪЯРСТУЖВЬХИЙКДЕФГЛМНОП▀┼┴┬┤├┘└┐┌│─0Support to work with card characters in unicode.hapytexeu+gh@gmail.comexperimentalPOSIXSafeХ╟рЦЄunicode-tricks╒A data type that represents the possible types of cards for which there is a Unicode characters. This is the back of a card, a card with a suit and rank, three jokers , and the 21 trump cards and the fool.╣unicode-tricksThe back of the card.Іunicode-tricks"A card that is a combination of a Ц and a т. There are 56 possibilities.Їunicode-tricksThree possible п cards.╧unicode-tricks0A data type for the trump cards, often used for tarot.╨unicode-tricksThe fool6 trump card, this tarot card is normally not numbered.╩unicode-tricksTarot card I.╪unicode-tricksTarot card II.Ґunicode-tricksTarot card III.Ўunicode-tricksTarot card IV.©unicode-tricksTarot card V.юunicode-tricksTarot card VI.аunicode-tricksTarot card VII.бunicode-tricksTarot card VIII.цunicode-tricksTarot card IX.дunicode-tricksTarot card X.еunicode-tricksTarot card XI.фunicode-tricksTarot card XII.гunicode-tricksTarot card XIII.хunicode-tricksTarot card XIV.иunicode-tricksTarot card XV.йunicode-tricksTarot card XVI.кunicode-tricksTarot card XVII.лunicode-tricksTarot card XVIII.мunicode-tricksTarot card XIX.нunicode-tricksTarot card XX.оunicode-tricksTarot card XXI.пunicode-tricksгA data type to represent the three colors for which there are jokers: red, black and white.яunicode-tricksThe red joker.рunicode-tricksThe black joker.сunicode-tricksThe white joker.тunicode-tricks%A data type for the rank of the card.уunicode-tricksThe ace card rank.жunicode-tricksCard rank 2.вunicode-tricksCard rank 3.ьunicode-tricksCard rank 4.ыunicode-tricksCard rank 5.зunicode-tricksCard rank 6.шunicode-tricksCard rank 7.эunicode-tricksCard rank 8.щunicode-tricksCard rank 9.чunicode-tricks Card rank 10.ъunicode-tricksThe jack card rank.Юunicode-tricksThe knight card rank.Аunicode-tricksThe queen card rank.Бunicode-tricksThe king card rank.Цunicode-tricksA data type for the card suitsДunicode-tricksThe spades card suit.Еunicode-tricksThe hearts card suit.Фunicode-tricksThe diamonds card suit.Гunicode-tricksThe clubs card suit.Хunicode-tricksThe trump card with number XXI is named collective.Иunicode-tricksThe trump card with number XX is named the game.Йunicode-tricksThe trump card with number XIX is named winter.Кunicode-tricksThe trump card with number XVIII is named autumn.Лunicode-tricksThe trump card with number XVII is named summer.Мunicode-tricksThe trump card with number XVI is named spring.Нunicode-tricksThe trump card with number XV is named visual arts.Оunicode-tricksThe trump card with number XIV is named open air.Пunicode-tricksThe trump card with number XIII is named shopping.Яunicode-tricksThe trump card with number XII is named dance.Рunicode-tricksThe trump card with number XI is named fire.Сunicode-tricksThe trump card with number XI is named water.Тunicode-tricksThe trump card with number X is named air.Уunicode-tricksThe trump card with number X is named earth.Жunicode-tricksThe trump card with number IX is named night.Вunicode-tricksThe trump card with number VIII is named evening.Ьunicode-tricksThe trump card with number VII is named afternoon.Ыunicode-tricksThe trump card with number VI is named morning.Зunicode-tricksThe trump card with number V is named old age.Шunicode-tricksThe trump card with number IV is named maturity.Эunicode-tricksThe trump card with number III is named youth.Щunicode-tricksThe trump card with number II is named childhood.Чunicode-tricksThe trump card with number I is named individual.Ъunicode-tricksIn Italy, the queen is sometimes called the re.─ unicode-tricksIn Germany, the king is sometimes called the kЖnig.│ unicode-tricksIn France, the king is sometimes called the roi.┌ unicode-tricksIn Italy, the queen is sometimes called the regina.┐ unicode-tricksIn Germany, the queen is sometimes called the kЖnigin.└ unicode-tricksAn alternative name for the queen is dame.┘ unicode-tricksAn alternative name for the jack is cavaliere.├ unicode-tricksAn alternative name for the jack is cavall.┤ unicode-tricksIn Germany, the knight is sometimes called the ritter.┬ unicode-tricksIn Germany, the knight is sometimes called the ober.┴ unicode-tricksIn France, the knight is sometimes called the chevalier.┼ unicode-tricksIn Italy, the jack is sometimes called the fante.▀ unicode-tricksAn alternative name for the jack is page.▄ unicode-tricks In Germany and Switzerland, the jack is sometimes called the unter.█ unicode-tricks)In Germany, Austria and Switzerland, the jack is sometimes called the bube.▌ unicode-tricksIn France, the jack is sometimes called the valet.▐ unicode-tricksWands is an alias for the clubs card suit.░ unicode-tricks Pentacles is an alias for the diamonds card suit.▒ unicode-tricksCups is an alias for the hearts card suit.▓ unicode-tricksSwords is an alias for the spades card suit.⌠ unicode-tricks*The unicode character that represents the back of the card.■ unicode-tricksConvert the given Ц and т4 to the equivalent unicode character for this card.∙ unicode-tricksConvert the given п= to the unicode character which represents this joker color.√ unicode-tricksюЇШ ╪ unicode-tricksхA data type that determines the state of the four subparts of the block.Ў unicode-tricksThe upper part of the block.© unicode-tricksThe lower part of the block.ю unicode-tricks-A data type that determines the state of the rowп in a block. it determines the left and the right part of the row of the block.б unicode-tricks$The left part of a row of the block.ц unicode-tricks'The right part of the row of the block.д unicode-tricksConvert the given уacter to a ╪ of Цs wrapped in a в if it exists; ь otherwise.е unicode-tricksConvert the given уacter to a ╪ of Ц-s if it exists; unspecified result otherwise.ф unicode-tricksConvert the given ╪ ) value to a block character in unicode. ы means that part is filled, and з means the part is not filled.д unicode-tricks The given уacter to convert to a ╪ of Цs.е unicode-tricks The given уacter to convert to a ╪ of Цs.unicode-tricksThe equivalent ╪ of Цs.ф unicode-tricks The given ╪ of Цs to convert to a уacter.unicode-tricksThe equivalent Unicode уacter for the given ╪ of Цs.╪ Ґ Ў © ю а б ц д е ф ю а б ц ╪ Ґ Ў © ф д е 6A module used to render Braille characters in unicode.hapytexeu+gh@gmail.comexperimentalPOSIXSafe567>юд┐ъ unicode-tricksаA datastructure to render Braille patterns with eight dots cells.А unicode-tricks2The state of the top row of the Braille character.Б unicode-tricks5The state of the second row of the Braille character.Ц unicode-tricks4The state of the third row of the Braille character.Д unicode-tricks5The state of the bottom row of the Braille character.Е unicode-tricks?A datastructure to render Braille patterns with six dots cells.Г unicode-tricks2The state of the top row of the Braille character.Х unicode-tricks5The state of the middle row of the Braille character.И unicode-tricks5The state of the bottom row of the Braille character.Й unicode-tricks Convert a Е value to a ъ м character, by putting in a given value at the two values at the bottom row.К unicode-tricks Convert a Е value to a Е / character by setting the bottom row with two з values.Л unicode-tricksConvert the given уacter to a ъ object of Ц$s. If the given character is not a Braille& character, the result is unspecified.М unicode-tricksConvert the given уacter to a Е object of Ц$s. If the given character is not a Braille character, or a Brailleж character where the lowest row contains filled dots, then the result is unspecified.Н unicode-tricksConvert the given уacter to a ъ object of Цs wrapped in a в". If the given character is not a Braille character, ь is returned.О unicode-tricksConvert the given уacter to a Е object of Цs wrapped in a в". If the given character is not a Braille character, or a Braille7 character where the lowest row contains filled dots, ь is returned.П unicode-tricksConvert the given Е ? value to a unicode character representing this Braille value.Я unicode-tricksConvert the given ъ ? value to a unicode character representing this braille value.Й unicode-tricks0The value to put in the cells of the bottom row.unicode-tricks The given Е value to convert.unicode-tricksA ъ ? value that uses as bottom two values given as first parameter.К unicode-tricks The given Е value to convert.unicode-tricksA ъ % value that uses as bottom two times з.Л unicode-tricks The given уacter to convert.unicode-tricksThe corresponding ъ object of Цs.М unicode-tricks The given уacter to convert.unicode-tricksThe corresponding Е object of Цs.Н unicode-tricks The given уacter to convert.unicode-tricksThe equivalent Е object of Цs wrapped in a в if it exists; ь otherwise.О unicode-tricks The given уacter to convert.unicode-tricksThe equivalent Е object of Цs wrapped in a в if it exists; ь otherwise.ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Е Ф Г Х И ъ Ю А Б Ц Д К Й П Я О М Н Л 1Support for the ballot box characters in unicode.hapytexeu+gh@gmail.comexperimentalPOSIXSafeхo┼unicode-tricks?A datatype that represents the different types of ballot boxes.▀unicode-tricksThe box is empty, this is represented with ░L.▄unicode-tricksThe box has a check, this is represented with ▒L.█unicode-tricksThe box has a cross, this is represented with ▓L.▌unicode-tricksConvert the given Ц ean to a ┼ that is ▀, or contains a ▄.▐unicode-tricksConvert the given Ц ean to a ┼ that is ▀, or contains a █.▌unicode-tricks The given Ц' that determines if the box contains a ▄.unicode-tricksThe corresponding ┼.▐unicode-tricks The given Ц' that determines if the box contains a █.unicode-tricksThe corresponding ┼.┼▀▄█▌▐┼▀▄█▌▐ 'Support for dice characters in unicode.hapytexeu+gh@gmail.comexperimentalPOSIXSafeмq ≥unicode-tricks)A data type to store the values of a die. unicode-tricksA die with value one, represented with ─M.⌡unicode-tricksA die with value two, represented with │M.°unicode-tricksA die with value three, represented with ┌M.²unicode-tricksA die with value four, represented with ┐M.·unicode-tricksA die with value five, represented with └M.÷unicode-tricksA die with value six, represented with ┘M.═unicode-tricks&Convert the given integral value to a ≥ы that represents the given number. If the number is less than one, or greater than six, ь is returned.║unicode-tricksConvert the given ≥* to a unicode character that represents a die with that value.═unicode-tricks)The given integral value to convert to a ≥.unicode-tricksA ≥ wrapped in a вр if the given integral value is greater than zero, and less than seven, otherwise ь.║unicode-tricksThe die value to convert.unicode-tricks9A unicode character that represents a die with the given ≥. ≥ ⌡°²·÷═║ ≥ ⌡°²·÷═║бA module that defines domino values, and their unicode equivalent.hapytexeu+gh@gmail.comexperimentalPOSIXSafe567>юХщT╚unicode-tricksA ╚ is a ў that contains Д values wrapping a ≥. In case of a ь, that side is considered empty.╛unicode-tricksA ╛ is a ў that contains ≥1 objects, it thus can not have an "empty" value.ґunicode-tricks!A type alias that specifies that ґ is an F type that wraps a ў item.ўunicode-tricksАA domino piece, which has two items. Depending on the orientation, the items are located at the top and bottom; or left and right.╞unicode-tricks#The front side of the domino piece.╟unicode-tricks"The back side of the domino piece.╠unicode-tricks The part that is located at the left# side in case the piece is located horizontally, or at the top in case the piece is located vertically.╡unicode-tricks The part that is located at the right# side in case the piece is located horizontally, or at the bottom in case the piece is located vertically.Ёunicode-tricksОA pattern synonym that makes it more convenient to write expressions that look like domino's like for example II :| IV.Єunicode-tricksConvert the given уacter to an F ╚ object. If the given убacter is not a valid domino character, the result is unspecified.╣unicode-tricksConvert the given уacter to an F ╚ object. If the given уacter wrapped in a в data constructor if the у.acter is a valid domino character; otherwise ь.Іunicode-tricks Convert a ╚: value to a unicode character rendering the domino value horizontally.Їunicode-tricks Convert a ╛: value to a unicode character rendering the domino value horizontally.╦unicode-tricks Convert a ╚: value to a unicode character rendering the domino value vertically.╧unicode-tricks Convert a ╛: value to a unicode character rendering the domino value vertically.╨unicode-tricksConvert an ґх to its unicode equivalent, where the sides of the domino can be empty.╩unicode-tricksConvert an ґ? to its unicode equivalent, where the sides of the domino can not be empty. Ёunicode-tricks1The item that is located at the left, or the top.unicode-tricks5The item that is located at the right, or the bottom.unicode-tricksThe domino that is constructed.Єunicode-tricks The given уacter to convert to an F ╚ object.unicode-tricksThe equivalent F ╚ object for the given уacter.╣unicode-tricks The given уacter to convert to an F ╚ object.unicode-tricksThe equivalent F ╚ object for the given уacter wrapped in a в; ь, if the character is not a domino character.Іunicode-tricksThe ╚ object to render horizontally.unicode-tricks0The unicode character that represents the given ╚ value in a horizontal manner.Їunicode-tricksThe ╛ object to render horizontally.unicode-tricks0The unicode character that represents the given ╛ value in a horizontal manner.╦unicode-tricksThe ╚ object to render vertically.unicode-tricks0The unicode character that represents the given ╚ value in a vertical manner.╧unicode-tricksThe ╛ object to render vertically.unicode-tricks0The unicode character that represents the given ╛ value in vertical manner.╨unicode-tricksThe ґ to render.unicode-tricks+The unicode characters that represents the ґ value.╩unicode-tricksThe ґ to render.unicode-tricks+The unicode characters that represents the ґ value.╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩ў╞╟╠╡Ёґ╛╚ІЇ╦╧╨╩╣ЄкA module that defines pattern synonyms for the 1099 hieroglyphs in Unicode.hapytexeu+gh@gmail.comexperimentalPOSIXSafeХ%ц╞кunicode-tricksThe Egyptian hieroglyph AA032 that renders as ўХ.лunicode-tricksThe Egyptian hieroglyph AA031 that renders as ґХ.мunicode-tricksThe Egyptian hieroglyph AA030 that renders as ╛Х.нunicode-tricksThe Egyptian hieroglyph AA029 that renders as ╚Х.оunicode-tricksThe Egyptian hieroglyph AA028 that renders as ╙Х.пunicode-tricksThe Egyptian hieroglyph AA027 that renders as ╘Х.яunicode-tricksThe Egyptian hieroglyph AA026 that renders as ╗Х.рunicode-tricksThe Egyptian hieroglyph AA025 that renders as їХ.сunicode-tricksThe Egyptian hieroglyph AA024 that renders as іХ.тunicode-tricksThe Egyptian hieroglyph AA023 that renders as ╔Х.уunicode-tricksThe Egyptian hieroglyph AA022 that renders as єХ.жunicode-tricksThe Egyptian hieroglyph AA021 that renders as ёХ.вunicode-tricksThe Egyptian hieroglyph AA020 that renders as ╒Х.ьunicode-tricksThe Egyptian hieroglyph AA019 that renders as ║Х.ыunicode-tricksThe Egyptian hieroglyph AA018 that renders as ═Х.зunicode-tricksThe Egyptian hieroglyph AA017 that renders as ÷Х.шunicode-tricksThe Egyptian hieroglyph AA016 that renders as ·Х.эunicode-tricksThe Egyptian hieroglyph AA015 that renders as ²Х.щunicode-tricksThe Egyptian hieroglyph AA014 that renders as °Х.чunicode-tricksThe Egyptian hieroglyph AA013 that renders as ⌡Х.ъunicode-tricksThe Egyptian hieroglyph AA012 that renders as Х.Юunicode-tricksThe Egyptian hieroglyph AA011 that renders as ≥Х.Аunicode-tricksThe Egyptian hieroglyph AA010 that renders as ≤Х.Бunicode-tricksThe Egyptian hieroglyph AA009 that renders as ≈Х.Цunicode-tricksThe Egyptian hieroglyph AA008 that renders as √Х.Дunicode-tricksThe Egyptian hieroglyph AA007B that renders as ∙Х.Еunicode-tricksThe Egyptian hieroglyph AA007A that renders as ■Х.Фunicode-tricksThe Egyptian hieroglyph AA007 that renders as ⌠Х.Гunicode-tricksThe Egyptian hieroglyph AA006 that renders as ▓Х.Хunicode-tricksThe Egyptian hieroglyph AA005 that renders as ▒Х.Иunicode-tricksThe Egyptian hieroglyph AA004 that renders as ░Х.Йunicode-tricksThe Egyptian hieroglyph AA003 that renders as ▐Х.Кunicode-tricksThe Egyptian hieroglyph AA002 that renders as ▌Х.Лunicode-tricksThe Egyptian hieroglyph AA001 that renders as █Х.Мunicode-tricksThe Egyptian hieroglyph Z016H that renders as ▄Х.Нunicode-tricksThe Egyptian hieroglyph Z016G that renders as ▀Х.Оunicode-tricksThe Egyptian hieroglyph Z016F that renders as ┼Х.Пunicode-tricksThe Egyptian hieroglyph Z016E that renders as ┴Х.Яunicode-tricksThe Egyptian hieroglyph Z016D that renders as ┬Х.Рunicode-tricksThe Egyptian hieroglyph Z016C that renders as ┤Х.Сunicode-tricksThe Egyptian hieroglyph Z016B that renders as ├Х.Тunicode-tricksThe Egyptian hieroglyph Z016A that renders as ┘Х.Уunicode-tricksThe Egyptian hieroglyph Z016 that renders as └Х.Жunicode-tricksThe Egyptian hieroglyph Z015I that renders as ┐Х.Вunicode-tricksThe Egyptian hieroglyph Z015H that renders as ┌Х.Ьunicode-tricksThe Egyptian hieroglyph Z015G that renders as │Х.Ыunicode-tricksThe Egyptian hieroglyph Z015F that renders as ─Х.Зunicode-tricksThe Egyptian hieroglyph Z015E that renders as ЪГ.Шunicode-tricksThe Egyptian hieroglyph Z015D that renders as ЧГ.Эunicode-tricksThe Egyptian hieroglyph Z015C that renders as ЩГ.Щunicode-tricksThe Egyptian hieroglyph Z015B that renders as ЭГ.Чunicode-tricksThe Egyptian hieroglyph Z015A that renders as ШГ.Ъunicode-tricksThe Egyptian hieroglyph Z015 that renders as ЗГ.─unicode-tricksThe Egyptian hieroglyph Z014 that renders as ЫГ.│unicode-tricksThe Egyptian hieroglyph Z013 that renders as ЬГ.┌unicode-tricksThe Egyptian hieroglyph Z012 that renders as ВГ.┐unicode-tricksThe Egyptian hieroglyph Z011 that renders as ЖГ.└unicode-tricksThe Egyptian hieroglyph Z010 that renders as УГ.┘unicode-tricksThe Egyptian hieroglyph Z009 that renders as ТГ.├unicode-tricksThe Egyptian hieroglyph Z008 that renders as СГ.┤unicode-tricksThe Egyptian hieroglyph Z007 that renders as РГ.┬unicode-tricksThe Egyptian hieroglyph Z006 that renders as ЯГ.┴unicode-tricksThe Egyptian hieroglyph Z005A that renders as ПГ.┼unicode-tricksThe Egyptian hieroglyph Z005 that renders as ОГ.▀unicode-tricksThe Egyptian hieroglyph Z004A that renders as НГ.▄unicode-tricksThe Egyptian hieroglyph Z004 that renders as МГ.█unicode-tricksThe Egyptian hieroglyph Z003B that renders as ЛГ.▌unicode-tricksThe Egyptian hieroglyph Z003A that renders as КГ.▐unicode-tricksThe Egyptian hieroglyph Z003 that renders as ЙГ.░unicode-tricksThe Egyptian hieroglyph Z002D that renders as ИГ.▒unicode-tricksThe Egyptian hieroglyph Z002C that renders as ХГ.▓unicode-tricksThe Egyptian hieroglyph Z002B that renders as ГГ.⌠unicode-tricksThe Egyptian hieroglyph Z002A that renders as ФГ.■unicode-tricksThe Egyptian hieroglyph Z002 that renders as ЕГ.∙unicode-tricksThe Egyptian hieroglyph Z001 that renders as ДГ.√unicode-tricksThe Egyptian hieroglyph Y008 that renders as ЦГ.≈unicode-tricksThe Egyptian hieroglyph Y007 that renders as БГ.≤unicode-tricksThe Egyptian hieroglyph Y006 that renders as АГ.≥unicode-tricksThe Egyptian hieroglyph Y005 that renders as ЮГ. unicode-tricksThe Egyptian hieroglyph Y004 that renders as ъГ.⌡unicode-tricksThe Egyptian hieroglyph Y003 that renders as чГ.°unicode-tricksThe Egyptian hieroglyph Y002 that renders as щГ.²unicode-tricksThe Egyptian hieroglyph Y001A that renders as эГ.·unicode-tricksThe Egyptian hieroglyph Y001 that renders as шГ.÷unicode-tricksThe Egyptian hieroglyph X008A that renders as зГ.═unicode-tricksThe Egyptian hieroglyph X008 that renders as ыГ.║unicode-tricksThe Egyptian hieroglyph X007 that renders as ьГ.╒unicode-tricksThe Egyptian hieroglyph X006A that renders as вГ.ёunicode-tricksThe Egyptian hieroglyph X006 that renders as жГ.єunicode-tricksThe Egyptian hieroglyph X005 that renders as уГ.╔unicode-tricksThe Egyptian hieroglyph X004B that renders as тГ.іunicode-tricksThe Egyptian hieroglyph X004A that renders as сГ.їunicode-tricksThe Egyptian hieroglyph X004 that renders as рГ.╗unicode-tricksThe Egyptian hieroglyph X003 that renders as яГ.╘unicode-tricksThe Egyptian hieroglyph X002 that renders as пГ.╙unicode-tricksThe Egyptian hieroglyph X001 that renders as оГ.╚unicode-tricksThe Egyptian hieroglyph W025 that renders as нГ.╛unicode-tricksThe Egyptian hieroglyph W024A that renders as мГ.ґunicode-tricksThe Egyptian hieroglyph W024 that renders as лГ.ўunicode-tricksThe Egyptian hieroglyph W023 that renders as кГ.╞unicode-tricksThe Egyptian hieroglyph W022 that renders as йГ.╟unicode-tricksThe Egyptian hieroglyph W021 that renders as иГ.╠unicode-tricksThe Egyptian hieroglyph W020 that renders as хГ.╡unicode-tricksThe Egyptian hieroglyph W019 that renders as гГ.Ёunicode-tricksThe Egyptian hieroglyph W018A that renders as фГ.Єunicode-tricksThe Egyptian hieroglyph W018 that renders as еГ.╣unicode-tricksThe Egyptian hieroglyph W017A that renders as дГ.Іunicode-tricksThe Egyptian hieroglyph W017 that renders as цГ.Їunicode-tricksThe Egyptian hieroglyph W016 that renders as бГ.╦unicode-tricksThe Egyptian hieroglyph W015 that renders as аГ.╧unicode-tricksThe Egyptian hieroglyph W014A that renders as юГ.╨unicode-tricksThe Egyptian hieroglyph W014 that renders as ©Г.╩unicode-tricksThe Egyptian hieroglyph W013 that renders as ЎГ.╪unicode-tricksThe Egyptian hieroglyph W012 that renders as ҐГ.Ґunicode-tricksThe Egyptian hieroglyph W011 that renders as ╪Г.Ўunicode-tricksThe Egyptian hieroglyph W010A that renders as ╩Г.©unicode-tricksThe Egyptian hieroglyph W010 that renders as ╨Г.юunicode-tricksThe Egyptian hieroglyph W009A that renders as ╧Г.аunicode-tricksThe Egyptian hieroglyph W009 that renders as ╦Г.бunicode-tricksThe Egyptian hieroglyph W008 that renders as ЇГ.цunicode-tricksThe Egyptian hieroglyph W007 that renders as ІГ.дunicode-tricksThe Egyptian hieroglyph W006 that renders as ╣Г.еunicode-tricksThe Egyptian hieroglyph W005 that renders as ЄГ.фunicode-tricksThe Egyptian hieroglyph W004 that renders as ЁГ.гunicode-tricksThe Egyptian hieroglyph W003A that renders as ╡Г.хunicode-tricksThe Egyptian hieroglyph W003 that renders as ╠Г.иunicode-tricksThe Egyptian hieroglyph W002 that renders as ╟Г.йunicode-tricksThe Egyptian hieroglyph W001 that renders as ╞Г.кunicode-tricksThe Egyptian hieroglyph V040A that renders as ўГ.лunicode-tricksThe Egyptian hieroglyph V040 that renders as ґГ.мunicode-tricksThe Egyptian hieroglyph V039 that renders as ╛Г.нunicode-tricksThe Egyptian hieroglyph V038 that renders as ╚Г.оunicode-tricksThe Egyptian hieroglyph V037A that renders as ╙Г.пunicode-tricksThe Egyptian hieroglyph V037 that renders as ╘Г.яunicode-tricksThe Egyptian hieroglyph V036 that renders as ╗Г.рunicode-tricksThe Egyptian hieroglyph V035 that renders as їГ.сunicode-tricksThe Egyptian hieroglyph V034 that renders as іГ.тunicode-tricksThe Egyptian hieroglyph V033A that renders as ╔Г.уunicode-tricksThe Egyptian hieroglyph V033 that renders as єГ.жunicode-tricksThe Egyptian hieroglyph V032 that renders as ёГ.вunicode-tricksThe Egyptian hieroglyph V031A that renders as ╒Г.ьunicode-tricksThe Egyptian hieroglyph V031 that renders as ║Г.ыunicode-tricksThe Egyptian hieroglyph V030A that renders as ═Г.зunicode-tricksThe Egyptian hieroglyph V030 that renders as ÷Г.шunicode-tricksThe Egyptian hieroglyph V029A that renders as ·Г.эunicode-tricksThe Egyptian hieroglyph V029 that renders as ²Г.щunicode-tricksThe Egyptian hieroglyph V028A that renders as °Г.чunicode-tricksThe Egyptian hieroglyph V028 that renders as ⌡Г.ъunicode-tricksThe Egyptian hieroglyph V027 that renders as Г.Юunicode-tricksThe Egyptian hieroglyph V026 that renders as ≥Г.Аunicode-tricksThe Egyptian hieroglyph V025 that renders as ≤Г.Бunicode-tricksThe Egyptian hieroglyph V024 that renders as ≈Г.Цunicode-tricksThe Egyptian hieroglyph V023A that renders as √Г.Дunicode-tricksThe Egyptian hieroglyph V023 that renders as ∙Г.Еunicode-tricksThe Egyptian hieroglyph V022 that renders as ■Г.Фunicode-tricksThe Egyptian hieroglyph V021 that renders as ⌠Г.Гunicode-tricksThe Egyptian hieroglyph V020L that renders as ▓Г.Хunicode-tricksThe Egyptian hieroglyph V020K that renders as ▒Г.Иunicode-tricksThe Egyptian hieroglyph V020J that renders as ░Г.Йunicode-tricksThe Egyptian hieroglyph V020I that renders as ▐Г.Кunicode-tricksThe Egyptian hieroglyph V020H that renders as ▌Г.Лunicode-tricksThe Egyptian hieroglyph V020G that renders as █Г.Мunicode-tricksThe Egyptian hieroglyph V020F that renders as ▄Г.Нunicode-tricksThe Egyptian hieroglyph V020E that renders as ▀Г.Оunicode-tricksThe Egyptian hieroglyph V020D that renders as ┼Г.Пunicode-tricksThe Egyptian hieroglyph V020C that renders as ┴Г.Яunicode-tricksThe Egyptian hieroglyph V020B that renders as ┬Г.Рunicode-tricksThe Egyptian hieroglyph V020A that renders as ┤Г.Сunicode-tricksThe Egyptian hieroglyph V020 that renders as ├Г.Тunicode-tricksThe Egyptian hieroglyph V019 that renders as ┘Г.Уunicode-tricksThe Egyptian hieroglyph V018 that renders as └Г.Жunicode-tricksThe Egyptian hieroglyph V017 that renders as ┐Г.Вunicode-tricksThe Egyptian hieroglyph V016 that renders as ┌Г.Ьunicode-tricksThe Egyptian hieroglyph V015 that renders as │Г.Ыunicode-tricksThe Egyptian hieroglyph V014 that renders as ─Г.Зunicode-tricksThe Egyptian hieroglyph V013 that renders as ЪФ.Шunicode-tricksThe Egyptian hieroglyph V012B that renders as ЧФ.Эunicode-tricksThe Egyptian hieroglyph V012A that renders as ЩФ.Щunicode-tricksThe Egyptian hieroglyph V012 that renders as ЭФ.Чunicode-tricksThe Egyptian hieroglyph V011C that renders as ШФ.Ъunicode-tricksThe Egyptian hieroglyph V011B that renders as ЗФ.─unicode-tricksThe Egyptian hieroglyph V011A that renders as ЫФ.│unicode-tricksThe Egyptian hieroglyph V011 that renders as ЬФ.┌unicode-tricksThe Egyptian hieroglyph V010 that renders as ВФ.┐unicode-tricksThe Egyptian hieroglyph V009 that renders as ЖФ.└unicode-tricksThe Egyptian hieroglyph V008 that renders as УФ.┘unicode-tricksThe Egyptian hieroglyph V007B that renders as ТФ.├unicode-tricksThe Egyptian hieroglyph V007A that renders as СФ.┤unicode-tricksThe Egyptian hieroglyph V007 that renders as РФ.┬unicode-tricksThe Egyptian hieroglyph V006 that renders as ЯФ.┴unicode-tricksThe Egyptian hieroglyph V005 that renders as ПФ.┼unicode-tricksThe Egyptian hieroglyph V004 that renders as ОФ.▀unicode-tricksThe Egyptian hieroglyph V003 that renders as НФ.▄unicode-tricksThe Egyptian hieroglyph V002A that renders as МФ.█unicode-tricksThe Egyptian hieroglyph V002 that renders as ЛФ.▌unicode-tricksThe Egyptian hieroglyph V001I that renders as КФ.▐unicode-tricksThe Egyptian hieroglyph V001H that renders as ЙФ.░unicode-tricksThe Egyptian hieroglyph V001G that renders as ИФ.▒unicode-tricksThe Egyptian hieroglyph V001F that renders as ХФ.▓unicode-tricksThe Egyptian hieroglyph V001E that renders as ГФ.⌠unicode-tricksThe Egyptian hieroglyph V001D that renders as ФФ.■unicode-tricksThe Egyptian hieroglyph V001C that renders as ЕФ.∙unicode-tricksThe Egyptian hieroglyph V001B that renders as ДФ.√unicode-tricksThe Egyptian hieroglyph V001A that renders as ЦФ.≈unicode-tricksThe Egyptian hieroglyph V001 that renders as БФ.≤unicode-tricksThe Egyptian hieroglyph U042 that renders as АФ.≥unicode-tricksThe Egyptian hieroglyph U041 that renders as ЮФ. unicode-tricksThe Egyptian hieroglyph U040 that renders as ъФ.⌡unicode-tricksThe Egyptian hieroglyph U039 that renders as чФ.°unicode-tricksThe Egyptian hieroglyph U038 that renders as щФ.²unicode-tricksThe Egyptian hieroglyph U037 that renders as эФ.·unicode-tricksThe Egyptian hieroglyph U036 that renders as шФ.÷unicode-tricksThe Egyptian hieroglyph U035 that renders as зФ.═unicode-tricksThe Egyptian hieroglyph U034 that renders as ыФ.║unicode-tricksThe Egyptian hieroglyph U033 that renders as ьФ.╒unicode-tricksThe Egyptian hieroglyph U032A that renders as вФ.ёunicode-tricksThe Egyptian hieroglyph U032 that renders as жФ.єunicode-tricksThe Egyptian hieroglyph U031 that renders as уФ.╔unicode-tricksThe Egyptian hieroglyph U030 that renders as тФ.іunicode-tricksThe Egyptian hieroglyph U029A that renders as сФ.їunicode-tricksThe Egyptian hieroglyph U029 that renders as рФ.╗unicode-tricksThe Egyptian hieroglyph U028 that renders as яФ.╘unicode-tricksThe Egyptian hieroglyph U027 that renders as пФ.╙unicode-tricksThe Egyptian hieroglyph U026 that renders as оФ.╚unicode-tricksThe Egyptian hieroglyph U025 that renders as нФ.╛unicode-tricksThe Egyptian hieroglyph U024 that renders as мФ.ґunicode-tricksThe Egyptian hieroglyph U023A that renders as лФ.ўunicode-tricksThe Egyptian hieroglyph U023 that renders as кФ.╞unicode-tricksThe Egyptian hieroglyph U022 that renders as йФ.╟unicode-tricksThe Egyptian hieroglyph U021 that renders as иФ.╠unicode-tricksThe Egyptian hieroglyph U020 that renders as хФ.╡unicode-tricksThe Egyptian hieroglyph U019 that renders as гФ.Ёunicode-tricksThe Egyptian hieroglyph U018 that renders as фФ.Єunicode-tricksThe Egyptian hieroglyph U017 that renders as еФ.╣unicode-tricksThe Egyptian hieroglyph U016 that renders as дФ.Іunicode-tricksThe Egyptian hieroglyph U015 that renders as цФ.Їunicode-tricksThe Egyptian hieroglyph U014 that renders as бФ.╦unicode-tricksThe Egyptian hieroglyph U013 that renders as аФ.╧unicode-tricksThe Egyptian hieroglyph U012 that renders as юФ.╨unicode-tricksThe Egyptian hieroglyph U011 that renders as ©Ф.╩unicode-tricksThe Egyptian hieroglyph U010 that renders as ЎФ.╪unicode-tricksThe Egyptian hieroglyph U009 that renders as ҐФ.Ґunicode-tricksThe Egyptian hieroglyph U008 that renders as ╪Ф.Ўunicode-tricksThe Egyptian hieroglyph U007 that renders as ╩Ф.©unicode-tricksThe Egyptian hieroglyph U006B that renders as ╨Ф.юunicode-tricksThe Egyptian hieroglyph U006A that renders as ╧Ф.аunicode-tricksThe Egyptian hieroglyph U006 that renders as ╦Ф.бunicode-tricksThe Egyptian hieroglyph U005 that renders as ЇФ.цunicode-tricksThe Egyptian hieroglyph U004 that renders as ІФ.дunicode-tricksThe Egyptian hieroglyph U003 that renders as ╣Ф.еunicode-tricksThe Egyptian hieroglyph U002 that renders as ЄФ.фunicode-tricksThe Egyptian hieroglyph U001 that renders as ЁФ.гunicode-tricksThe Egyptian hieroglyph T036 that renders as ╡Ф.хunicode-tricksThe Egyptian hieroglyph T035 that renders as ╠Ф.иunicode-tricksThe Egyptian hieroglyph T034 that renders as ╟Ф.йunicode-tricksThe Egyptian hieroglyph T033A that renders as ╞Ф.кunicode-tricksThe Egyptian hieroglyph T033 that renders as ўФ.лunicode-tricksThe Egyptian hieroglyph T032A that renders as ґФ.мunicode-tricksThe Egyptian hieroglyph T032 that renders as ╛Ф.нunicode-tricksThe Egyptian hieroglyph T031 that renders as ╚Ф.оunicode-tricksThe Egyptian hieroglyph T030 that renders as ╙Ф.пunicode-tricksThe Egyptian hieroglyph T029 that renders as ╘Ф.яunicode-tricksThe Egyptian hieroglyph T028 that renders as ╗Ф.рunicode-tricksThe Egyptian hieroglyph T027 that renders as їФ.сunicode-tricksThe Egyptian hieroglyph T026 that renders as іФ.тunicode-tricksThe Egyptian hieroglyph T025 that renders as ╔Ф.уunicode-tricksThe Egyptian hieroglyph T024 that renders as єФ.жunicode-tricksThe Egyptian hieroglyph T023 that renders as ёФ.вunicode-tricksThe Egyptian hieroglyph T022 that renders as ╒Ф.ьunicode-tricksThe Egyptian hieroglyph T021 that renders as ║Ф.ыunicode-tricksThe Egyptian hieroglyph T020 that renders as ═Ф.зunicode-tricksThe Egyptian hieroglyph T019 that renders as ÷Ф.шunicode-tricksThe Egyptian hieroglyph T018 that renders as ·Ф.эunicode-tricksThe Egyptian hieroglyph T017 that renders as ²Ф.щunicode-tricksThe Egyptian hieroglyph T016A that renders as °Ф.чunicode-tricksThe Egyptian hieroglyph T016 that renders as ⌡Ф.ъunicode-tricksThe Egyptian hieroglyph T015 that renders as Ф.Юunicode-tricksThe Egyptian hieroglyph T014 that renders as ≥Ф.Аunicode-tricksThe Egyptian hieroglyph T013 that renders as ≤Ф.Бunicode-tricksThe Egyptian hieroglyph T012 that renders as ≈Ф.Цunicode-tricksThe Egyptian hieroglyph T011A that renders as √Ф.Дunicode-tricksThe Egyptian hieroglyph T011 that renders as ∙Ф.Еunicode-tricksThe Egyptian hieroglyph T010 that renders as ■Ф.Фunicode-tricksThe Egyptian hieroglyph T009A that renders as ⌠Ф.Гunicode-tricksThe Egyptian hieroglyph T009 that renders as ▓Ф.Хunicode-tricksThe Egyptian hieroglyph T008A that renders as ▒Ф.Иunicode-tricksThe Egyptian hieroglyph T008 that renders as ░Ф.Йunicode-tricksThe Egyptian hieroglyph T007A that renders as ▐Ф.Кunicode-tricksThe Egyptian hieroglyph T007 that renders as ▌Ф.Лunicode-tricksThe Egyptian hieroglyph T006 that renders as █Ф.Мunicode-tricksThe Egyptian hieroglyph T005 that renders as ▄Ф.Нunicode-tricksThe Egyptian hieroglyph T004 that renders as ▀Ф.Оunicode-tricksThe Egyptian hieroglyph T003A that renders as ┼Ф.Пunicode-tricksThe Egyptian hieroglyph T003 that renders as ┴Ф.Яunicode-tricksThe Egyptian hieroglyph T002 that renders as ┬Ф.Рunicode-tricksThe Egyptian hieroglyph T001 that renders as ┤Ф.Сunicode-tricksThe Egyptian hieroglyph S046 that renders as ├Ф.Тunicode-tricksThe Egyptian hieroglyph S045 that renders as ┘Ф.Уunicode-tricksThe Egyptian hieroglyph S044 that renders as └Ф.Жunicode-tricksThe Egyptian hieroglyph S043 that renders as ┐Ф.Вunicode-tricksThe Egyptian hieroglyph S042 that renders as ┌Ф.Ьunicode-tricksThe Egyptian hieroglyph S041 that renders as │Ф.Ыunicode-tricksThe Egyptian hieroglyph S040 that renders as ─Ф.Зunicode-tricksThe Egyptian hieroglyph S039 that renders as ЪЕ.Шunicode-tricksThe Egyptian hieroglyph S038 that renders as ЧЕ.Эunicode-tricksThe Egyptian hieroglyph S037 that renders as ЩЕ.Щunicode-tricksThe Egyptian hieroglyph S036 that renders as ЭЕ.Чunicode-tricksThe Egyptian hieroglyph S035A that renders as ШЕ.Ъunicode-tricksThe Egyptian hieroglyph S035 that renders as ЗЕ.─unicode-tricksThe Egyptian hieroglyph S034 that renders as ЫЕ.│unicode-tricksThe Egyptian hieroglyph S033 that renders as ЬЕ.┌unicode-tricksThe Egyptian hieroglyph S032 that renders as ВЕ.┐unicode-tricksThe Egyptian hieroglyph S031 that renders as ЖЕ.└unicode-tricksThe Egyptian hieroglyph S030 that renders as УЕ.┘unicode-tricksThe Egyptian hieroglyph S029 that renders as ТЕ.├unicode-tricksThe Egyptian hieroglyph S028 that renders as СЕ.┤unicode-tricksThe Egyptian hieroglyph S027 that renders as РЕ.┬unicode-tricksThe Egyptian hieroglyph S026B that renders as ЯЕ.┴unicode-tricksThe Egyptian hieroglyph S026A that renders as ПЕ.┼unicode-tricksThe Egyptian hieroglyph S026 that renders as ОЕ.▀unicode-tricksThe Egyptian hieroglyph S025 that renders as НЕ.▄unicode-tricksThe Egyptian hieroglyph S024 that renders as МЕ.█unicode-tricksThe Egyptian hieroglyph S023 that renders as ЛЕ.▌unicode-tricksThe Egyptian hieroglyph S022 that renders as КЕ.▐unicode-tricksThe Egyptian hieroglyph S021 that renders as ЙЕ.░unicode-tricksThe Egyptian hieroglyph S020 that renders as ИЕ.▒unicode-tricksThe Egyptian hieroglyph S019 that renders as ХЕ.▓unicode-tricksThe Egyptian hieroglyph S018 that renders as ГЕ.⌠unicode-tricksThe Egyptian hieroglyph S017A that renders as ФЕ.■unicode-tricksThe Egyptian hieroglyph S017 that renders as ЕЕ.∙unicode-tricksThe Egyptian hieroglyph S016 that renders as ДЕ.√unicode-tricksThe Egyptian hieroglyph S015 that renders as ЦЕ.≈unicode-tricksThe Egyptian hieroglyph S014B that renders as БЕ.≤unicode-tricksThe Egyptian hieroglyph S014A that renders as АЕ.≥unicode-tricksThe Egyptian hieroglyph S014 that renders as ЮЕ. unicode-tricksThe Egyptian hieroglyph S013 that renders as ъЕ.⌡unicode-tricksThe Egyptian hieroglyph S012 that renders as чЕ.°unicode-tricksThe Egyptian hieroglyph S011 that renders as щЕ.²unicode-tricksThe Egyptian hieroglyph S010 that renders as эЕ.·unicode-tricksThe Egyptian hieroglyph S009 that renders as шЕ.÷unicode-tricksThe Egyptian hieroglyph S008 that renders as зЕ.═unicode-tricksThe Egyptian hieroglyph S007 that renders as ыЕ.║unicode-tricksThe Egyptian hieroglyph S006A that renders as ьЕ.╒unicode-tricksThe Egyptian hieroglyph S006 that renders as вЕ.ёunicode-tricksThe Egyptian hieroglyph S005 that renders as жЕ.єunicode-tricksThe Egyptian hieroglyph S004 that renders as уЕ.╔unicode-tricksThe Egyptian hieroglyph S003 that renders as тЕ.іunicode-tricksThe Egyptian hieroglyph S002A that renders as сЕ.їunicode-tricksThe Egyptian hieroglyph S002 that renders as рЕ.╗unicode-tricksThe Egyptian hieroglyph S001 that renders as яЕ.╘unicode-tricksThe Egyptian hieroglyph R029 that renders as пЕ.╙unicode-tricksThe Egyptian hieroglyph R028 that renders as оЕ.╚unicode-tricksThe Egyptian hieroglyph R027 that renders as нЕ.╛unicode-tricksThe Egyptian hieroglyph R026 that renders as мЕ.ґunicode-tricksThe Egyptian hieroglyph R025 that renders as лЕ.ўunicode-tricksThe Egyptian hieroglyph R024 that renders as кЕ.╞unicode-tricksThe Egyptian hieroglyph R023 that renders as йЕ.╟unicode-tricksThe Egyptian hieroglyph R022 that renders as иЕ.╠unicode-tricksThe Egyptian hieroglyph R021 that renders as хЕ.╡unicode-tricksThe Egyptian hieroglyph R020 that renders as гЕ.Ёunicode-tricksThe Egyptian hieroglyph R019 that renders as фЕ.Єunicode-tricksThe Egyptian hieroglyph R018 that renders as еЕ.╣unicode-tricksThe Egyptian hieroglyph R017 that renders as дЕ.Іunicode-tricksThe Egyptian hieroglyph R016A that renders as цЕ.Їunicode-tricksThe Egyptian hieroglyph R016 that renders as бЕ.╦unicode-tricksThe Egyptian hieroglyph R015 that renders as аЕ.╧unicode-tricksThe Egyptian hieroglyph R014 that renders as юЕ.╨unicode-tricksThe Egyptian hieroglyph R013 that renders as ©Е.╩unicode-tricksThe Egyptian hieroglyph R012 that renders as ЎЕ.╪unicode-tricksThe Egyptian hieroglyph R011 that renders as ҐЕ.Ґunicode-tricksThe Egyptian hieroglyph R010A that renders as ╪Е.Ўunicode-tricksThe Egyptian hieroglyph R010 that renders as ╩Е.©unicode-tricksThe Egyptian hieroglyph R009 that renders as ╨Е.юunicode-tricksThe Egyptian hieroglyph R008 that renders as ╧Е.аunicode-tricksThe Egyptian hieroglyph R007 that renders as ╦Е.бunicode-tricksThe Egyptian hieroglyph R006 that renders as ЇЕ.цunicode-tricksThe Egyptian hieroglyph R005 that renders as ІЕ.дunicode-tricksThe Egyptian hieroglyph R004 that renders as ╣Е.еunicode-tricksThe Egyptian hieroglyph R003B that renders as ЄЕ.фunicode-tricksThe Egyptian hieroglyph R003A that renders as ЁЕ.гunicode-tricksThe Egyptian hieroglyph R003 that renders as ╡Е.хunicode-tricksThe Egyptian hieroglyph R002A that renders as ╠Е.иunicode-tricksThe Egyptian hieroglyph R002 that renders as ╟Е.йunicode-tricksThe Egyptian hieroglyph R001 that renders as ╞Е.кunicode-tricksThe Egyptian hieroglyph Q007 that renders as ўЕ.лunicode-tricksThe Egyptian hieroglyph Q006 that renders as ґЕ.мunicode-tricksThe Egyptian hieroglyph Q005 that renders as ╛Е.нunicode-tricksThe Egyptian hieroglyph Q004 that renders as ╚Е.оunicode-tricksThe Egyptian hieroglyph Q003 that renders as ╙Е.пunicode-tricksThe Egyptian hieroglyph Q002 that renders as ╘Е.яunicode-tricksThe Egyptian hieroglyph Q001 that renders as ╗Е.рunicode-tricksThe Egyptian hieroglyph P011 that renders as їЕ.сunicode-tricksThe Egyptian hieroglyph P010 that renders as іЕ.тunicode-tricksThe Egyptian hieroglyph P009 that renders as ╔Е.уunicode-tricksThe Egyptian hieroglyph P008 that renders as єЕ.жunicode-tricksThe Egyptian hieroglyph P007 that renders as ёЕ.вunicode-tricksThe Egyptian hieroglyph P006 that renders as ╒Е.ьunicode-tricksThe Egyptian hieroglyph P005 that renders as ║Е.ыunicode-tricksThe Egyptian hieroglyph P004 that renders as ═Е.зunicode-tricksThe Egyptian hieroglyph P003A that renders as ÷Е.шunicode-tricksThe Egyptian hieroglyph P003 that renders as ·Е.эunicode-tricksThe Egyptian hieroglyph P002 that renders as ²Е.щunicode-tricksThe Egyptian hieroglyph P001A that renders as °Е.чunicode-tricksThe Egyptian hieroglyph P001 that renders as ⌡Е.ъunicode-tricksThe Egyptian hieroglyph O051 that renders as Е.Юunicode-tricksThe Egyptian hieroglyph O050B that renders as ≥Е.Аunicode-tricksThe Egyptian hieroglyph O050A that renders as ≤Е.Бunicode-tricksThe Egyptian hieroglyph O050 that renders as ≈Е.Цunicode-tricksThe Egyptian hieroglyph O049 that renders as √Е.Дunicode-tricksThe Egyptian hieroglyph O048 that renders as ∙Е.Еunicode-tricksThe Egyptian hieroglyph O047 that renders as ■Е.Фunicode-tricksThe Egyptian hieroglyph O046 that renders as ⌠Е.Гunicode-tricksThe Egyptian hieroglyph O045 that renders as ▓Е.Хunicode-tricksThe Egyptian hieroglyph O044 that renders as ▒Е.Иunicode-tricksThe Egyptian hieroglyph O043 that renders as ░Е.Йunicode-tricksThe Egyptian hieroglyph O042 that renders as ▐Е.Кunicode-tricksThe Egyptian hieroglyph O041 that renders as ▌Е.Лunicode-tricksThe Egyptian hieroglyph O040 that renders as █Е.Мunicode-tricksThe Egyptian hieroglyph O039 that renders as ▄Е.Нunicode-tricksThe Egyptian hieroglyph O038 that renders as ▀Е.Оunicode-tricksThe Egyptian hieroglyph O037 that renders as ┼Е.Пunicode-tricksThe Egyptian hieroglyph O036D that renders as ┴Е.Яunicode-tricksThe Egyptian hieroglyph O036C that renders as ┬Е.Рunicode-tricksThe Egyptian hieroglyph O036B that renders as ┤Е.Сunicode-tricksThe Egyptian hieroglyph O036A that renders as ├Е.Тunicode-tricksThe Egyptian hieroglyph O036 that renders as ┘Е.Уunicode-tricksThe Egyptian hieroglyph O035 that renders as └Е.Жunicode-tricksThe Egyptian hieroglyph O034 that renders as ┐Е.Вunicode-tricksThe Egyptian hieroglyph O033A that renders as ┌Е.Ьunicode-tricksThe Egyptian hieroglyph O033 that renders as │Е.Ыunicode-tricksThe Egyptian hieroglyph O032 that renders as ─Е.Зunicode-tricksThe Egyptian hieroglyph O031 that renders as ЪД.Шunicode-tricksThe Egyptian hieroglyph O030A that renders as ЧД.Эunicode-tricksThe Egyptian hieroglyph O030 that renders as ЩД.Щunicode-tricksThe Egyptian hieroglyph O029A that renders as ЭД.Чunicode-tricksThe Egyptian hieroglyph O029 that renders as ШД.Ъunicode-tricksThe Egyptian hieroglyph O028 that renders as ЗД.─unicode-tricksThe Egyptian hieroglyph O027 that renders as ЫД.│unicode-tricksThe Egyptian hieroglyph O026 that renders as ЬД.┌unicode-tricksThe Egyptian hieroglyph O025A that renders as ВД.┐unicode-tricksThe Egyptian hieroglyph O025 that renders as ЖД.└unicode-tricksThe Egyptian hieroglyph O024A that renders as УД.┘unicode-tricksThe Egyptian hieroglyph O024 that renders as ТД.├unicode-tricksThe Egyptian hieroglyph O023 that renders as СД.┤unicode-tricksThe Egyptian hieroglyph O022 that renders as РД.┬unicode-tricksThe Egyptian hieroglyph O021 that renders as ЯД.┴unicode-tricksThe Egyptian hieroglyph O020A that renders as ПД.┼unicode-tricksThe Egyptian hieroglyph O020 that renders as ОД.▀unicode-tricksThe Egyptian hieroglyph O019A that renders as НД.▄unicode-tricksThe Egyptian hieroglyph O019 that renders as МД.█unicode-tricksThe Egyptian hieroglyph O018 that renders as ЛД.▌unicode-tricksThe Egyptian hieroglyph O017 that renders as КД.▐unicode-tricksThe Egyptian hieroglyph O016 that renders as ЙД.░unicode-tricksThe Egyptian hieroglyph O015 that renders as ИД.▒unicode-tricksThe Egyptian hieroglyph O014 that renders as ХД.▓unicode-tricksThe Egyptian hieroglyph O013 that renders as ГД.⌠unicode-tricksThe Egyptian hieroglyph O012 that renders as ФД.■unicode-tricksThe Egyptian hieroglyph O011 that renders as ЕД.∙unicode-tricksThe Egyptian hieroglyph O010C that renders as ДД.√unicode-tricksThe Egyptian hieroglyph O010B that renders as ЦД.≈unicode-tricksThe Egyptian hieroglyph O010A that renders as БД.≤unicode-tricksThe Egyptian hieroglyph O010 that renders as АД.≥unicode-tricksThe Egyptian hieroglyph O009 that renders as ЮД. unicode-tricksThe Egyptian hieroglyph O008 that renders as ъД.⌡unicode-tricksThe Egyptian hieroglyph O007 that renders as чД.°unicode-tricksThe Egyptian hieroglyph O006F that renders as щД.²unicode-tricksThe Egyptian hieroglyph O006E that renders as эД.·unicode-tricksThe Egyptian hieroglyph O006D that renders as шД.÷unicode-tricksThe Egyptian hieroglyph O006C that renders as зД.═unicode-tricksThe Egyptian hieroglyph O006B that renders as ыД.║unicode-tricksThe Egyptian hieroglyph O006A that renders as ьД.╒unicode-tricksThe Egyptian hieroglyph O006 that renders as вД.ёunicode-tricksThe Egyptian hieroglyph O005A that renders as жД.єunicode-tricksThe Egyptian hieroglyph O005 that renders as уД.╔unicode-tricksThe Egyptian hieroglyph O004 that renders as тД.іunicode-tricksThe Egyptian hieroglyph O003 that renders as сД.їunicode-tricksThe Egyptian hieroglyph O002 that renders as рД.╗unicode-tricksThe Egyptian hieroglyph O001A that renders as яД.╘unicode-tricksThe Egyptian hieroglyph O001 that renders as пД.╙unicode-tricksThe Egyptian hieroglyph NU022A that renders as оД.╚unicode-tricksThe Egyptian hieroglyph NU022 that renders as нД.╛unicode-tricksThe Egyptian hieroglyph NU021 that renders as мД.ґunicode-tricksThe Egyptian hieroglyph NU020 that renders as лД.ўunicode-tricksThe Egyptian hieroglyph NU019 that renders as кД.╞unicode-tricksThe Egyptian hieroglyph NU018A that renders as йД.╟unicode-tricksThe Egyptian hieroglyph NU018 that renders as иД.╠unicode-tricksThe Egyptian hieroglyph NU017 that renders as хД.╡unicode-tricksThe Egyptian hieroglyph NU016 that renders as гД.Ёunicode-tricksThe Egyptian hieroglyph NU015 that renders as фД.Єunicode-tricksThe Egyptian hieroglyph NU014 that renders as еД.╣unicode-tricksThe Egyptian hieroglyph NU013 that renders as дД.Іunicode-tricksThe Egyptian hieroglyph NU012 that renders as цД.Їunicode-tricksThe Egyptian hieroglyph NU011A that renders as бД.╦unicode-tricksThe Egyptian hieroglyph NU011 that renders as аД.╧unicode-tricksThe Egyptian hieroglyph NU010A that renders as юД.╨unicode-tricksThe Egyptian hieroglyph NU010 that renders as ©Д.╩unicode-tricksThe Egyptian hieroglyph NU009 that renders as ЎД.╪unicode-tricksThe Egyptian hieroglyph NU008 that renders as ҐД.Ґunicode-tricksThe Egyptian hieroglyph NU007 that renders as ╪Д.Ўunicode-tricksThe Egyptian hieroglyph NU006 that renders as ╩Д.©unicode-tricksThe Egyptian hieroglyph NU005 that renders as ╨Д.юunicode-tricksThe Egyptian hieroglyph NU004 that renders as ╧Д.аunicode-tricksThe Egyptian hieroglyph NU003 that renders as ╦Д.бunicode-tricksThe Egyptian hieroglyph NU002 that renders as ЇД.цunicode-tricksThe Egyptian hieroglyph NU001 that renders as ІД.дunicode-tricksThe Egyptian hieroglyph NL020 that renders as ╣Д.еunicode-tricksThe Egyptian hieroglyph NL019 that renders as ЄД.фunicode-tricksThe Egyptian hieroglyph NL018 that renders as ЁД.гunicode-tricksThe Egyptian hieroglyph NL017A that renders as ╡Д.хunicode-tricksThe Egyptian hieroglyph NL017 that renders as ╠Д.иunicode-tricksThe Egyptian hieroglyph NL016 that renders as ╟Д.йunicode-tricksThe Egyptian hieroglyph NL015 that renders as ╞Д.кunicode-tricksThe Egyptian hieroglyph NL014 that renders as ўД.лunicode-tricksThe Egyptian hieroglyph NL013 that renders as ґД.мunicode-tricksThe Egyptian hieroglyph NL012 that renders as ╛Д.нunicode-tricksThe Egyptian hieroglyph NL011 that renders as ╚Д.оunicode-tricksThe Egyptian hieroglyph NL010 that renders as ╙Д.пunicode-tricksThe Egyptian hieroglyph NL009 that renders as ╘Д.яunicode-tricksThe Egyptian hieroglyph NL008 that renders as ╗Д.рunicode-tricksThe Egyptian hieroglyph NL007 that renders as їД.сunicode-tricksThe Egyptian hieroglyph NL006 that renders as іД.тunicode-tricksThe Egyptian hieroglyph NL005A that renders as ╔Д.уunicode-tricksThe Egyptian hieroglyph NL005 that renders as єД.жunicode-tricksThe Egyptian hieroglyph NL004 that renders as ёД.вunicode-tricksThe Egyptian hieroglyph NL003 that renders as ╒Д.ьunicode-tricksThe Egyptian hieroglyph NL002 that renders as ║Д.ыunicode-tricksThe Egyptian hieroglyph NL001 that renders as ═Д.зunicode-tricksThe Egyptian hieroglyph N042 that renders as ÷Д.шunicode-tricksThe Egyptian hieroglyph N041 that renders as ·Д.эunicode-tricksThe Egyptian hieroglyph N040 that renders as ²Д.щunicode-tricksThe Egyptian hieroglyph N039 that renders as °Д.чunicode-tricksThe Egyptian hieroglyph N038 that renders as ⌡Д.ъunicode-tricksThe Egyptian hieroglyph N037A that renders as Д.Юunicode-tricksThe Egyptian hieroglyph N037 that renders as ≥Д.Аunicode-tricksThe Egyptian hieroglyph N036 that renders as ≤Д.Бunicode-tricksThe Egyptian hieroglyph N035A that renders as ≈Д.Цunicode-tricksThe Egyptian hieroglyph N035 that renders as √Д.Дunicode-tricksThe Egyptian hieroglyph N034A that renders as ∙Д.Еunicode-tricksThe Egyptian hieroglyph N034 that renders as ■Д.Фunicode-tricksThe Egyptian hieroglyph N033A that renders as ⌠Д.Гunicode-tricksThe Egyptian hieroglyph N033 that renders as ▓Д.Хunicode-tricksThe Egyptian hieroglyph N032 that renders as ▒Д.Иunicode-tricksThe Egyptian hieroglyph N031 that renders as ░Д.Йunicode-tricksThe Egyptian hieroglyph N030 that renders as ▐Д.Кunicode-tricksThe Egyptian hieroglyph N029 that renders as ▌Д.Лunicode-tricksThe Egyptian hieroglyph N028 that renders as █Д.Мunicode-tricksThe Egyptian hieroglyph N027 that renders as ▄Д.Нunicode-tricksThe Egyptian hieroglyph N026 that renders as ▀Д.Оunicode-tricksThe Egyptian hieroglyph N025A that renders as ┼Д.Пunicode-tricksThe Egyptian hieroglyph N025 that renders as ┴Д.Яunicode-tricksThe Egyptian hieroglyph N024 that renders as ┬Д.Рunicode-tricksThe Egyptian hieroglyph N023 that renders as ┤Д.Сunicode-tricksThe Egyptian hieroglyph N022 that renders as ├Д.Тunicode-tricksThe Egyptian hieroglyph N021 that renders as ┘Д.Уunicode-tricksThe Egyptian hieroglyph N020 that renders as └Д.Жunicode-tricksThe Egyptian hieroglyph N019 that renders as ┐Д.Вunicode-tricksThe Egyptian hieroglyph N018B that renders as ┌Д.Ьunicode-tricksThe Egyptian hieroglyph N018A that renders as │Д.Ыunicode-tricksThe Egyptian hieroglyph N018 that renders as ─Д.Зunicode-tricksThe Egyptian hieroglyph N017 that renders as ЪЦ.Шunicode-tricksThe Egyptian hieroglyph N016 that renders as ЧЦ.Эunicode-tricksThe Egyptian hieroglyph N015 that renders as ЩЦ.Щunicode-tricksThe Egyptian hieroglyph N014 that renders as ЭЦ.Чunicode-tricksThe Egyptian hieroglyph N013 that renders as ШЦ.Ъunicode-tricksThe Egyptian hieroglyph N012 that renders as ЗЦ.─unicode-tricksThe Egyptian hieroglyph N011 that renders as ЫЦ.│unicode-tricksThe Egyptian hieroglyph N010 that renders as ЬЦ.┌unicode-tricksThe Egyptian hieroglyph N009 that renders as ВЦ.┐unicode-tricksThe Egyptian hieroglyph N008 that renders as ЖЦ.└unicode-tricksThe Egyptian hieroglyph N007 that renders as УЦ.┘unicode-tricksThe Egyptian hieroglyph N006 that renders as ТЦ.├unicode-tricksThe Egyptian hieroglyph N005 that renders as СЦ.┤unicode-tricksThe Egyptian hieroglyph N004 that renders as РЦ.┬unicode-tricksThe Egyptian hieroglyph N003 that renders as ЯЦ.┴unicode-tricksThe Egyptian hieroglyph N002 that renders as ПЦ.┼unicode-tricksThe Egyptian hieroglyph N001 that renders as ОЦ.▀unicode-tricksThe Egyptian hieroglyph M044 that renders as НЦ.▄unicode-tricksThe Egyptian hieroglyph M043 that renders as МЦ.█unicode-tricksThe Egyptian hieroglyph M042 that renders as ЛЦ.▌unicode-tricksThe Egyptian hieroglyph M041 that renders as КЦ.▐unicode-tricksThe Egyptian hieroglyph M040A that renders as ЙЦ.░unicode-tricksThe Egyptian hieroglyph M040 that renders as ИЦ.▒unicode-tricksThe Egyptian hieroglyph M039 that renders as ХЦ.▓unicode-tricksThe Egyptian hieroglyph M038 that renders as ГЦ.⌠unicode-tricksThe Egyptian hieroglyph M037 that renders as ФЦ.■unicode-tricksThe Egyptian hieroglyph M036 that renders as ЕЦ.∙unicode-tricksThe Egyptian hieroglyph M035 that renders as ДЦ.√unicode-tricksThe Egyptian hieroglyph M034 that renders as ЦЦ.≈unicode-tricksThe Egyptian hieroglyph M033B that renders as БЦ.≤unicode-tricksThe Egyptian hieroglyph M033A that renders as АЦ.≥unicode-tricksThe Egyptian hieroglyph M033 that renders as ЮЦ. unicode-tricksThe Egyptian hieroglyph M032 that renders as ъЦ.⌡unicode-tricksThe Egyptian hieroglyph M031A that renders as чЦ.°unicode-tricksThe Egyptian hieroglyph M031 that renders as щЦ.²unicode-tricksThe Egyptian hieroglyph M030 that renders as эЦ.·unicode-tricksThe Egyptian hieroglyph M029 that renders as шЦ.÷unicode-tricksThe Egyptian hieroglyph M028A that renders as зЦ.═unicode-tricksThe Egyptian hieroglyph M028 that renders as ыЦ.║unicode-tricksThe Egyptian hieroglyph M027 that renders as ьЦ.╒unicode-tricksThe Egyptian hieroglyph M026 that renders as вЦ.ёunicode-tricksThe Egyptian hieroglyph M025 that renders as жЦ.єunicode-tricksThe Egyptian hieroglyph M024A that renders as уЦ.╔unicode-tricksThe Egyptian hieroglyph M024 that renders as тЦ.іunicode-tricksThe Egyptian hieroglyph M023 that renders as сЦ.їunicode-tricksThe Egyptian hieroglyph M022A that renders as рЦ.╗unicode-tricksThe Egyptian hieroglyph M022 that renders as яЦ.╘unicode-tricksThe Egyptian hieroglyph M021 that renders as пЦ.╙unicode-tricksThe Egyptian hieroglyph M020 that renders as оЦ.╚unicode-tricksThe Egyptian hieroglyph M019 that renders as нЦ.╛unicode-tricksThe Egyptian hieroglyph M018 that renders as мЦ.ґunicode-tricksThe Egyptian hieroglyph M017A that renders as лЦ.ўunicode-tricksThe Egyptian hieroglyph M017 that renders as кЦ.╞unicode-tricksThe Egyptian hieroglyph M016A that renders as йЦ.╟unicode-tricksThe Egyptian hieroglyph M016 that renders as иЦ.╠unicode-tricksThe Egyptian hieroglyph M015A that renders as хЦ.╡unicode-tricksThe Egyptian hieroglyph M015 that renders as гЦ.Ёunicode-tricksThe Egyptian hieroglyph M014 that renders as фЦ.Єunicode-tricksThe Egyptian hieroglyph M013 that renders as еЦ.╣unicode-tricksThe Egyptian hieroglyph M012H that renders as дЦ.Іunicode-tricksThe Egyptian hieroglyph M012G that renders as цЦ.Їunicode-tricksThe Egyptian hieroglyph M012F that renders as бЦ.╦unicode-tricksThe Egyptian hieroglyph M012E that renders as аЦ.╧unicode-tricksThe Egyptian hieroglyph M012D that renders as юЦ.╨unicode-tricksThe Egyptian hieroglyph M012C that renders as ©Ц.╩unicode-tricksThe Egyptian hieroglyph M012B that renders as ЎЦ.╪unicode-tricksThe Egyptian hieroglyph M012A that renders as ҐЦ.Ґunicode-tricksThe Egyptian hieroglyph M012 that renders as ╪Ц.Ўunicode-tricksThe Egyptian hieroglyph M011 that renders as ╩Ц.©unicode-tricksThe Egyptian hieroglyph M010A that renders as ╨Ц.юunicode-tricksThe Egyptian hieroglyph M010 that renders as ╧Ц.аunicode-tricksThe Egyptian hieroglyph M009 that renders as ╦Ц.бunicode-tricksThe Egyptian hieroglyph M008 that renders as ЇЦ.цunicode-tricksThe Egyptian hieroglyph M007 that renders as ІЦ.дunicode-tricksThe Egyptian hieroglyph M006 that renders as ╣Ц.еunicode-tricksThe Egyptian hieroglyph M005 that renders as ЄЦ.фunicode-tricksThe Egyptian hieroglyph M004 that renders as ЁЦ.гunicode-tricksThe Egyptian hieroglyph M003A that renders as ╡Ц.хunicode-tricksThe Egyptian hieroglyph M003 that renders as ╠Ц.иunicode-tricksThe Egyptian hieroglyph M002 that renders as ╟Ц.йunicode-tricksThe Egyptian hieroglyph M001B that renders as ╞Ц.кunicode-tricksThe Egyptian hieroglyph M001A that renders as ўЦ.лunicode-tricksThe Egyptian hieroglyph M001 that renders as ґЦ.мunicode-tricksThe Egyptian hieroglyph L008 that renders as ╛Ц.нunicode-tricksThe Egyptian hieroglyph L007 that renders as ╚Ц.оunicode-tricksThe Egyptian hieroglyph L006A that renders as ╙Ц.пunicode-tricksThe Egyptian hieroglyph L006 that renders as ╘Ц.яunicode-tricksThe Egyptian hieroglyph L005 that renders as ╗Ц.рunicode-tricksThe Egyptian hieroglyph L004 that renders as їЦ.сunicode-tricksThe Egyptian hieroglyph L003 that renders as іЦ.тunicode-tricksThe Egyptian hieroglyph L002A that renders as ╔Ц.уunicode-tricksThe Egyptian hieroglyph L002 that renders as єЦ.жunicode-tricksThe Egyptian hieroglyph L001 that renders as ёЦ.вunicode-tricksThe Egyptian hieroglyph K008 that renders as ╒Ц.ьunicode-tricksThe Egyptian hieroglyph K007 that renders as ║Ц.ыunicode-tricksThe Egyptian hieroglyph K006 that renders as ═Ц.зunicode-tricksThe Egyptian hieroglyph K005 that renders as ÷Ц.шunicode-tricksThe Egyptian hieroglyph K004 that renders as ·Ц.эunicode-tricksThe Egyptian hieroglyph K003 that renders as ²Ц.щunicode-tricksThe Egyptian hieroglyph K002 that renders as °Ц.чunicode-tricksThe Egyptian hieroglyph K001 that renders as ⌡Ц.ъunicode-tricksThe Egyptian hieroglyph I015 that renders as Ц.Юunicode-tricksThe Egyptian hieroglyph I014 that renders as ≥Ц.Аunicode-tricksThe Egyptian hieroglyph I013 that renders as ≤Ц.Бunicode-tricksThe Egyptian hieroglyph I012 that renders as ≈Ц.Цunicode-tricksThe Egyptian hieroglyph I011A that renders as √Ц.Дunicode-tricksThe Egyptian hieroglyph I011 that renders as ∙Ц.Еunicode-tricksThe Egyptian hieroglyph I010A that renders as ■Ц.Фunicode-tricksThe Egyptian hieroglyph I010 that renders as ⌠Ц.Гunicode-tricksThe Egyptian hieroglyph I009A that renders as ▓Ц.Хunicode-tricksThe Egyptian hieroglyph I009 that renders as ▒Ц.Иunicode-tricksThe Egyptian hieroglyph I008 that renders as ░Ц.Йunicode-tricksThe Egyptian hieroglyph I007 that renders as ▐Ц.Кunicode-tricksThe Egyptian hieroglyph I006 that renders as ▌Ц.Лunicode-tricksThe Egyptian hieroglyph I005A that renders as █Ц.Мunicode-tricksThe Egyptian hieroglyph I005 that renders as ▄Ц.Нunicode-tricksThe Egyptian hieroglyph I004 that renders as ▀Ц.Оunicode-tricksThe Egyptian hieroglyph I003 that renders as ┼Ц.Пunicode-tricksThe Egyptian hieroglyph I002 that renders as ┴Ц.Яunicode-tricksThe Egyptian hieroglyph I001 that renders as ┬Ц.Рunicode-tricksThe Egyptian hieroglyph H008 that renders as ┤Ц.Сunicode-tricksThe Egyptian hieroglyph H007 that renders as ├Ц.Тunicode-tricksThe Egyptian hieroglyph H006A that renders as ┘Ц.Уunicode-tricksThe Egyptian hieroglyph H006 that renders as └Ц.Жunicode-tricksThe Egyptian hieroglyph H005 that renders as ┐Ц.Вunicode-tricksThe Egyptian hieroglyph H004 that renders as ┌Ц.Ьunicode-tricksThe Egyptian hieroglyph H003 that renders as │Ц.Ыunicode-tricksThe Egyptian hieroglyph H002 that renders as ─Ц.Зunicode-tricksThe Egyptian hieroglyph H001 that renders as ЪБ.Шunicode-tricksThe Egyptian hieroglyph G054 that renders as ЧБ.Эunicode-tricksThe Egyptian hieroglyph G053 that renders as ЩБ.Щunicode-tricksThe Egyptian hieroglyph G052 that renders as ЭБ.Чunicode-tricksThe Egyptian hieroglyph G051 that renders as ШБ.Ъunicode-tricksThe Egyptian hieroglyph G050 that renders as ЗБ.─unicode-tricksThe Egyptian hieroglyph G049 that renders as ЫБ.│unicode-tricksThe Egyptian hieroglyph G048 that renders as ЬБ.┌unicode-tricksThe Egyptian hieroglyph G047 that renders as ВБ.┐unicode-tricksThe Egyptian hieroglyph G046 that renders as ЖБ.└unicode-tricksThe Egyptian hieroglyph G045A that renders as УБ.┘unicode-tricksThe Egyptian hieroglyph G045 that renders as ТБ.├unicode-tricksThe Egyptian hieroglyph G044 that renders as СБ.┤unicode-tricksThe Egyptian hieroglyph G043A that renders as РБ.┬unicode-tricksThe Egyptian hieroglyph G043 that renders as ЯБ.┴unicode-tricksThe Egyptian hieroglyph G042 that renders as ПБ.┼unicode-tricksThe Egyptian hieroglyph G041 that renders as ОБ.▀unicode-tricksThe Egyptian hieroglyph G040 that renders as НБ.▄unicode-tricksThe Egyptian hieroglyph G039 that renders as МБ.█unicode-tricksThe Egyptian hieroglyph G038 that renders as ЛБ.▌unicode-tricksThe Egyptian hieroglyph G037A that renders as КБ.▐unicode-tricksThe Egyptian hieroglyph G037 that renders as ЙБ.░unicode-tricksThe Egyptian hieroglyph G036A that renders as ИБ.▒unicode-tricksThe Egyptian hieroglyph G036 that renders as ХБ.▓unicode-tricksThe Egyptian hieroglyph G035 that renders as ГБ.⌠unicode-tricksThe Egyptian hieroglyph G034 that renders as ФБ.■unicode-tricksThe Egyptian hieroglyph G033 that renders as ЕБ.∙unicode-tricksThe Egyptian hieroglyph G032 that renders as ДБ.√unicode-tricksThe Egyptian hieroglyph G031 that renders as ЦБ.≈unicode-tricksThe Egyptian hieroglyph G030 that renders as ББ.≤unicode-tricksThe Egyptian hieroglyph G029 that renders as АБ.≥unicode-tricksThe Egyptian hieroglyph G028 that renders as ЮБ. unicode-tricksThe Egyptian hieroglyph G027 that renders as ъБ.⌡unicode-tricksThe Egyptian hieroglyph G026A that renders as чБ.°unicode-tricksThe Egyptian hieroglyph G026 that renders as щБ.²unicode-tricksThe Egyptian hieroglyph G025 that renders as эБ.·unicode-tricksThe Egyptian hieroglyph G024 that renders as шБ.÷unicode-tricksThe Egyptian hieroglyph G023 that renders as зБ.═unicode-tricksThe Egyptian hieroglyph G022 that renders as ыБ.║unicode-tricksThe Egyptian hieroglyph G021 that renders as ьБ.╒unicode-tricksThe Egyptian hieroglyph G020A that renders as вБ.ёunicode-tricksThe Egyptian hieroglyph G020 that renders as жБ.єunicode-tricksThe Egyptian hieroglyph G019 that renders as уБ.╔unicode-tricksThe Egyptian hieroglyph G018 that renders as тБ.іunicode-tricksThe Egyptian hieroglyph G017 that renders as сБ.їunicode-tricksThe Egyptian hieroglyph G016 that renders as рБ.╗unicode-tricksThe Egyptian hieroglyph G015 that renders as яБ.╘unicode-tricksThe Egyptian hieroglyph G014 that renders as пБ.╙unicode-tricksThe Egyptian hieroglyph G013 that renders as оБ.╚unicode-tricksThe Egyptian hieroglyph G012 that renders as нБ.╛unicode-tricksThe Egyptian hieroglyph G011A that renders as мБ.ґunicode-tricksThe Egyptian hieroglyph G011 that renders as лБ.ўunicode-tricksThe Egyptian hieroglyph G010 that renders as кБ.╞unicode-tricksThe Egyptian hieroglyph G009 that renders as йБ.╟unicode-tricksThe Egyptian hieroglyph G008 that renders as иБ.╠unicode-tricksThe Egyptian hieroglyph G007B that renders as хБ.╡unicode-tricksThe Egyptian hieroglyph G007A that renders as гБ.Ёunicode-tricksThe Egyptian hieroglyph G007 that renders as фБ.Єunicode-tricksThe Egyptian hieroglyph G006A that renders as еБ.╣unicode-tricksThe Egyptian hieroglyph G006 that renders as дБ.Іunicode-tricksThe Egyptian hieroglyph G005 that renders as цБ.Їunicode-tricksThe Egyptian hieroglyph G004 that renders as бБ.╦unicode-tricksThe Egyptian hieroglyph G003 that renders as аБ.╧unicode-tricksThe Egyptian hieroglyph G002 that renders as юБ.╨unicode-tricksThe Egyptian hieroglyph G001 that renders as ©Б.╩unicode-tricksThe Egyptian hieroglyph F053 that renders as ЎБ.╪unicode-tricksThe Egyptian hieroglyph F052 that renders as ҐБ.Ґunicode-tricksThe Egyptian hieroglyph F051C that renders as ╪Б.Ўunicode-tricksThe Egyptian hieroglyph F051B that renders as ╩Б.©unicode-tricksThe Egyptian hieroglyph F051A that renders as ╨Б.юunicode-tricksThe Egyptian hieroglyph F051 that renders as ╧Б.аunicode-tricksThe Egyptian hieroglyph F050 that renders as ╦Б.бunicode-tricksThe Egyptian hieroglyph F049 that renders as ЇБ.цunicode-tricksThe Egyptian hieroglyph F048 that renders as ІБ.дunicode-tricksThe Egyptian hieroglyph F047A that renders as ╣Б.еunicode-tricksThe Egyptian hieroglyph F047 that renders as ЄБ.фunicode-tricksThe Egyptian hieroglyph F046A that renders as ЁБ.гunicode-tricksThe Egyptian hieroglyph F046 that renders as ╡Б.хunicode-tricksThe Egyptian hieroglyph F045A that renders as ╠Б.иunicode-tricksThe Egyptian hieroglyph F045 that renders as ╟Б.йunicode-tricksThe Egyptian hieroglyph F044 that renders as ╞Б.кunicode-tricksThe Egyptian hieroglyph F043 that renders as ўБ.лunicode-tricksThe Egyptian hieroglyph F042 that renders as ґБ.мunicode-tricksThe Egyptian hieroglyph F041 that renders as ╛Б.нunicode-tricksThe Egyptian hieroglyph F040 that renders as ╚Б.оunicode-tricksThe Egyptian hieroglyph F039 that renders as ╙Б.пunicode-tricksThe Egyptian hieroglyph F038A that renders as ╘Б.яunicode-tricksThe Egyptian hieroglyph F038 that renders as ╗Б.рunicode-tricksThe Egyptian hieroglyph F037A that renders as їБ.сunicode-tricksThe Egyptian hieroglyph F037 that renders as іБ.тunicode-tricksThe Egyptian hieroglyph F036 that renders as ╔Б.уunicode-tricksThe Egyptian hieroglyph F035 that renders as єБ.жunicode-tricksThe Egyptian hieroglyph F034 that renders as ёБ.вunicode-tricksThe Egyptian hieroglyph F033 that renders as ╒Б.ьunicode-tricksThe Egyptian hieroglyph F032 that renders as ║Б.ыunicode-tricksThe Egyptian hieroglyph F031A that renders as ═Б.зunicode-tricksThe Egyptian hieroglyph F031 that renders as ÷Б.шunicode-tricksThe Egyptian hieroglyph F030 that renders as ·Б.эunicode-tricksThe Egyptian hieroglyph F029 that renders as ²Б.щunicode-tricksThe Egyptian hieroglyph F028 that renders as °Б.чunicode-tricksThe Egyptian hieroglyph F027 that renders as ⌡Б.ъunicode-tricksThe Egyptian hieroglyph F026 that renders as Б.Юunicode-tricksThe Egyptian hieroglyph F025 that renders as ≥Б.Аunicode-tricksThe Egyptian hieroglyph F024 that renders as ≤Б.Бunicode-tricksThe Egyptian hieroglyph F023 that renders as ≈Б.Цunicode-tricksThe Egyptian hieroglyph F022 that renders as √Б.Дunicode-tricksThe Egyptian hieroglyph F021A that renders as ∙Б.Еunicode-tricksThe Egyptian hieroglyph F021 that renders as ■Б.Фunicode-tricksThe Egyptian hieroglyph F020 that renders as ⌠Б.Гunicode-tricksThe Egyptian hieroglyph F019 that renders as ▓Б.Хunicode-tricksThe Egyptian hieroglyph F018 that renders as ▒Б.Иunicode-tricksThe Egyptian hieroglyph F017 that renders as ░Б.Йunicode-tricksThe Egyptian hieroglyph F016 that renders as ▐Б.Кunicode-tricksThe Egyptian hieroglyph F015 that renders as ▌Б.Лunicode-tricksThe Egyptian hieroglyph F014 that renders as █Б.Мunicode-tricksThe Egyptian hieroglyph F013A that renders as ▄Б.Нunicode-tricksThe Egyptian hieroglyph F013 that renders as ▀Б.Оunicode-tricksThe Egyptian hieroglyph F012 that renders as ┼Б.Пunicode-tricksThe Egyptian hieroglyph F011 that renders as ┴Б.Яunicode-tricksThe Egyptian hieroglyph F010 that renders as ┬Б.Рunicode-tricksThe Egyptian hieroglyph F009 that renders as ┤Б.Сunicode-tricksThe Egyptian hieroglyph F008 that renders as ├Б.Тunicode-tricksThe Egyptian hieroglyph F007 that renders as ┘Б.Уunicode-tricksThe Egyptian hieroglyph F006 that renders as └Б.Жunicode-tricksThe Egyptian hieroglyph F005 that renders as ┐Б.Вunicode-tricksThe Egyptian hieroglyph F004 that renders as ┌Б.Ьunicode-tricksThe Egyptian hieroglyph F003 that renders as │Б.Ыunicode-tricksThe Egyptian hieroglyph F002 that renders as ─Б.Зunicode-tricksThe Egyptian hieroglyph F001A that renders as ЪА.Шunicode-tricksThe Egyptian hieroglyph F001 that renders as ЧА.Эunicode-tricksThe Egyptian hieroglyph E038 that renders as ЩА.Щunicode-tricksThe Egyptian hieroglyph E037 that renders as ЭА.Чunicode-tricksThe Egyptian hieroglyph E036 that renders as ША.Ъunicode-tricksThe Egyptian hieroglyph E034A that renders as ЗА.─unicode-tricksThe Egyptian hieroglyph E034 that renders as ЫА.│unicode-tricksThe Egyptian hieroglyph E033 that renders as ЬА.┌unicode-tricksThe Egyptian hieroglyph E032 that renders as ВА.┐unicode-tricksThe Egyptian hieroglyph E031 that renders as ЖА.└unicode-tricksThe Egyptian hieroglyph E030 that renders as УА.┘unicode-tricksThe Egyptian hieroglyph E029 that renders as ТА.├unicode-tricksThe Egyptian hieroglyph E028A that renders as СА.┤unicode-tricksThe Egyptian hieroglyph E028 that renders as РА.┬unicode-tricksThe Egyptian hieroglyph E027 that renders as ЯА.┴unicode-tricksThe Egyptian hieroglyph E026 that renders as ПА.┼unicode-tricksThe Egyptian hieroglyph E025 that renders as ОА.▀unicode-tricksThe Egyptian hieroglyph E024 that renders as НА.▄unicode-tricksThe Egyptian hieroglyph E023 that renders as МА.█unicode-tricksThe Egyptian hieroglyph E022 that renders as ЛА.▌unicode-tricksThe Egyptian hieroglyph E021 that renders as КА.▐unicode-tricksThe Egyptian hieroglyph E020A that renders as ЙА.░unicode-tricksThe Egyptian hieroglyph E020 that renders as ИА.▒unicode-tricksThe Egyptian hieroglyph E019 that renders as ХА.▓unicode-tricksThe Egyptian hieroglyph E018 that renders as ГА.⌠unicode-tricksThe Egyptian hieroglyph E017A that renders as ФА.■unicode-tricksThe Egyptian hieroglyph E017 that renders as ЕА.∙unicode-tricksThe Egyptian hieroglyph E016A that renders as ДА.√unicode-tricksThe Egyptian hieroglyph E016 that renders as ЦА.≈unicode-tricksThe Egyptian hieroglyph E015 that renders as БА.≤unicode-tricksThe Egyptian hieroglyph E014 that renders as АА.≥unicode-tricksThe Egyptian hieroglyph E013 that renders as ЮА. unicode-tricksThe Egyptian hieroglyph E012 that renders as ъА.⌡unicode-tricksThe Egyptian hieroglyph E011 that renders as чА.°unicode-tricksThe Egyptian hieroglyph E010 that renders as щА.²unicode-tricksThe Egyptian hieroglyph E009A that renders as эА.·unicode-tricksThe Egyptian hieroglyph E009 that renders as шА.÷unicode-tricksThe Egyptian hieroglyph E008A that renders as зА.═unicode-tricksThe Egyptian hieroglyph E008 that renders as ыА.║unicode-tricksThe Egyptian hieroglyph E007 that renders as ьА.╒unicode-tricksThe Egyptian hieroglyph E006 that renders as вА.ёunicode-tricksThe Egyptian hieroglyph E005 that renders as жА.єunicode-tricksThe Egyptian hieroglyph E004 that renders as уА.╔unicode-tricksThe Egyptian hieroglyph E003 that renders as тА.іunicode-tricksThe Egyptian hieroglyph E002 that renders as сА.їunicode-tricksThe Egyptian hieroglyph E001 that renders as рА.╗unicode-tricksThe Egyptian hieroglyph D067H that renders as яА.╘unicode-tricksThe Egyptian hieroglyph D067G that renders as пА.╙unicode-tricksThe Egyptian hieroglyph D067F that renders as оА.╚unicode-tricksThe Egyptian hieroglyph D067E that renders as нА.╛unicode-tricksThe Egyptian hieroglyph D067D that renders as мА.ґunicode-tricksThe Egyptian hieroglyph D067C that renders as лА.ўunicode-tricksThe Egyptian hieroglyph D067B that renders as кА.╞unicode-tricksThe Egyptian hieroglyph D067A that renders as йА.╟unicode-tricksThe Egyptian hieroglyph D067 that renders as иА.╠unicode-tricksThe Egyptian hieroglyph D066 that renders as хА.╡unicode-tricksThe Egyptian hieroglyph D065 that renders as гА.Ёunicode-tricksThe Egyptian hieroglyph D064 that renders as фА.Єunicode-tricksThe Egyptian hieroglyph D063 that renders as еА.╣unicode-tricksThe Egyptian hieroglyph D062 that renders as дА.Іunicode-tricksThe Egyptian hieroglyph D061 that renders as цА.Їunicode-tricksThe Egyptian hieroglyph D060 that renders as бА.╦unicode-tricksThe Egyptian hieroglyph D059 that renders as аА.╧unicode-tricksThe Egyptian hieroglyph D058 that renders as юА.╨unicode-tricksThe Egyptian hieroglyph D057 that renders as ©А.╩unicode-tricksThe Egyptian hieroglyph D056 that renders as ЎА.╪unicode-tricksThe Egyptian hieroglyph D055 that renders as ҐА.Ґunicode-tricksThe Egyptian hieroglyph D054A that renders as ╪А.Ўunicode-tricksThe Egyptian hieroglyph D054 that renders as ╩А.©unicode-tricksThe Egyptian hieroglyph D053 that renders as ╨А.юunicode-tricksThe Egyptian hieroglyph D052A that renders as ╧А.аunicode-tricksThe Egyptian hieroglyph D052 that renders as ╦А.бunicode-tricksThe Egyptian hieroglyph D051 that renders as ЇА.цunicode-tricksThe Egyptian hieroglyph D050I that renders as ІА.дunicode-tricksThe Egyptian hieroglyph D050H that renders as ╣А.еunicode-tricksThe Egyptian hieroglyph D050G that renders as ЄА.фunicode-tricksThe Egyptian hieroglyph D050F that renders as ЁА.гunicode-tricksThe Egyptian hieroglyph D050E that renders as ╡А.хunicode-tricksThe Egyptian hieroglyph D050D that renders as ╠А.иunicode-tricksThe Egyptian hieroglyph D050C that renders as ╟А.йunicode-tricksThe Egyptian hieroglyph D050B that renders as ╞А.кunicode-tricksThe Egyptian hieroglyph D050A that renders as ўА.лunicode-tricksThe Egyptian hieroglyph D050 that renders as ґА.мunicode-tricksThe Egyptian hieroglyph D049 that renders as ╛А.нunicode-tricksThe Egyptian hieroglyph D048A that renders as ╚А.оunicode-tricksThe Egyptian hieroglyph D048 that renders as ╙А.пunicode-tricksThe Egyptian hieroglyph D047 that renders as ╘А.яunicode-tricksThe Egyptian hieroglyph D046A that renders as ╗А.рunicode-tricksThe Egyptian hieroglyph D046 that renders as їА.сunicode-tricksThe Egyptian hieroglyph D045 that renders as іА.тunicode-tricksThe Egyptian hieroglyph D044 that renders as ╔А.уunicode-tricksThe Egyptian hieroglyph D043 that renders as єА.жunicode-tricksThe Egyptian hieroglyph D042 that renders as ёА.вunicode-tricksThe Egyptian hieroglyph D041 that renders as ╒А.ьunicode-tricksThe Egyptian hieroglyph D040 that renders as ║А.ыunicode-tricksThe Egyptian hieroglyph D039 that renders as ═А.зunicode-tricksThe Egyptian hieroglyph D038 that renders as ÷А.шunicode-tricksThe Egyptian hieroglyph D037 that renders as ·А.эunicode-tricksThe Egyptian hieroglyph D036 that renders as ²А.щunicode-tricksThe Egyptian hieroglyph D035 that renders as °А.чunicode-tricksThe Egyptian hieroglyph D034A that renders as ⌡А.ъunicode-tricksThe Egyptian hieroglyph D034 that renders as А.Юunicode-tricksThe Egyptian hieroglyph D033 that renders as ≥А.Аunicode-tricksThe Egyptian hieroglyph D032 that renders as ≤А.Бunicode-tricksThe Egyptian hieroglyph D031A that renders as ≈А.Цunicode-tricksThe Egyptian hieroglyph D031 that renders as √А.Дunicode-tricksThe Egyptian hieroglyph D030 that renders as ∙А.Еunicode-tricksThe Egyptian hieroglyph D029 that renders as ■А.Фunicode-tricksThe Egyptian hieroglyph D028 that renders as ⌠А.Гunicode-tricksThe Egyptian hieroglyph D027A that renders as ▓А.Хunicode-tricksThe Egyptian hieroglyph D027 that renders as ▒А.Иunicode-tricksThe Egyptian hieroglyph D026 that renders as ░А.Йunicode-tricksThe Egyptian hieroglyph D025 that renders as ▐А.Кunicode-tricksThe Egyptian hieroglyph D024 that renders as ▌А.Лunicode-tricksThe Egyptian hieroglyph D023 that renders as █А.Мunicode-tricksThe Egyptian hieroglyph D022 that renders as ▄А.Нunicode-tricksThe Egyptian hieroglyph D021 that renders as ▀А.Оunicode-tricksThe Egyptian hieroglyph D020 that renders as ┼А.Пunicode-tricksThe Egyptian hieroglyph D019 that renders as ┴А.Яunicode-tricksThe Egyptian hieroglyph D018 that renders as ┬А.Рunicode-tricksThe Egyptian hieroglyph D017 that renders as ┤А.Сunicode-tricksThe Egyptian hieroglyph D016 that renders as ├А.Тunicode-tricksThe Egyptian hieroglyph D015 that renders as ┘А.Уunicode-tricksThe Egyptian hieroglyph D014 that renders as └А.Жunicode-tricksThe Egyptian hieroglyph D013 that renders as ┐А.Вunicode-tricksThe Egyptian hieroglyph D012 that renders as ┌А.Ьunicode-tricksThe Egyptian hieroglyph D011 that renders as │А.Ыunicode-tricksThe Egyptian hieroglyph D010 that renders as ─А.Зunicode-tricksThe Egyptian hieroglyph D009 that renders as ЪЮ.Шunicode-tricksThe Egyptian hieroglyph D008A that renders as ЧЮ.Эunicode-tricksThe Egyptian hieroglyph D008 that renders as ЩЮ.Щunicode-tricksThe Egyptian hieroglyph D007 that renders as ЭЮ.Чunicode-tricksThe Egyptian hieroglyph D006 that renders as ШЮ.Ъunicode-tricksThe Egyptian hieroglyph D005 that renders as ЗЮ.─unicode-tricksThe Egyptian hieroglyph D004 that renders as ЫЮ.│unicode-tricksThe Egyptian hieroglyph D003 that renders as ЬЮ.┌unicode-tricksThe Egyptian hieroglyph D002 that renders as ВЮ.┐unicode-tricksThe Egyptian hieroglyph D001 that renders as ЖЮ.└unicode-tricksThe Egyptian hieroglyph C024 that renders as УЮ.┘unicode-tricksThe Egyptian hieroglyph C023 that renders as ТЮ.├unicode-tricksThe Egyptian hieroglyph C022 that renders as СЮ.┤unicode-tricksThe Egyptian hieroglyph C021 that renders as РЮ.┬unicode-tricksThe Egyptian hieroglyph C020 that renders as ЯЮ.┴unicode-tricksThe Egyptian hieroglyph C019 that renders as ПЮ.┼unicode-tricksThe Egyptian hieroglyph C018 that renders as ОЮ.▀unicode-tricksThe Egyptian hieroglyph C017 that renders as НЮ.▄unicode-tricksThe Egyptian hieroglyph C016 that renders as МЮ.█unicode-tricksThe Egyptian hieroglyph C015 that renders as ЛЮ.▌unicode-tricksThe Egyptian hieroglyph C014 that renders as КЮ.▐unicode-tricksThe Egyptian hieroglyph C013 that renders as ЙЮ.░unicode-tricksThe Egyptian hieroglyph C012 that renders as ИЮ.▒unicode-tricksThe Egyptian hieroglyph C011 that renders as ХЮ.▓unicode-tricksThe Egyptian hieroglyph C010A that renders as ГЮ.⌠unicode-tricksThe Egyptian hieroglyph C010 that renders as ФЮ.■unicode-tricksThe Egyptian hieroglyph C009 that renders as ЕЮ.∙unicode-tricksThe Egyptian hieroglyph C008 that renders as ДЮ.√unicode-tricksThe Egyptian hieroglyph C007 that renders as ЦЮ.≈unicode-tricksThe Egyptian hieroglyph C006 that renders as БЮ.≤unicode-tricksThe Egyptian hieroglyph C005 that renders as АЮ.≥unicode-tricksThe Egyptian hieroglyph C004 that renders as ЮЮ. unicode-tricksThe Egyptian hieroglyph C003 that renders as ъЮ.⌡unicode-tricksThe Egyptian hieroglyph C002C that renders as чЮ.°unicode-tricksThe Egyptian hieroglyph C002B that renders as щЮ.²unicode-tricksThe Egyptian hieroglyph C002A that renders as эЮ.·unicode-tricksThe Egyptian hieroglyph C002 that renders as шЮ.÷unicode-tricksThe Egyptian hieroglyph C001 that renders as зЮ.═unicode-tricksThe Egyptian hieroglyph B009 that renders as ыЮ.║unicode-tricksThe Egyptian hieroglyph B008 that renders as ьЮ.╒unicode-tricksThe Egyptian hieroglyph B007 that renders as вЮ.ёunicode-tricksThe Egyptian hieroglyph B006 that renders as жЮ.єunicode-tricksThe Egyptian hieroglyph B005A that renders as уЮ.╔unicode-tricksThe Egyptian hieroglyph B005 that renders as тЮ.іunicode-tricksThe Egyptian hieroglyph B004 that renders as сЮ.їunicode-tricksThe Egyptian hieroglyph B003 that renders as рЮ.╗unicode-tricksThe Egyptian hieroglyph B002 that renders as яЮ.╘unicode-tricksThe Egyptian hieroglyph B001 that renders as пЮ.╙unicode-tricksThe Egyptian hieroglyph A070 that renders as оЮ.╚unicode-tricksThe Egyptian hieroglyph A069 that renders as нЮ.╛unicode-tricksThe Egyptian hieroglyph A068 that renders as мЮ.ґunicode-tricksThe Egyptian hieroglyph A067 that renders as лЮ.ўunicode-tricksThe Egyptian hieroglyph A066 that renders as кЮ.╞unicode-tricksThe Egyptian hieroglyph A065 that renders as йЮ.╟unicode-tricksThe Egyptian hieroglyph A064 that renders as иЮ.╠unicode-tricksThe Egyptian hieroglyph A063 that renders as хЮ.╡unicode-tricksThe Egyptian hieroglyph A062 that renders as гЮ.Ёunicode-tricksThe Egyptian hieroglyph A061 that renders as фЮ.Єunicode-tricksThe Egyptian hieroglyph A060 that renders as еЮ.╣unicode-tricksThe Egyptian hieroglyph A059 that renders as дЮ.Іunicode-tricksThe Egyptian hieroglyph A058 that renders as цЮ.Їunicode-tricksThe Egyptian hieroglyph A057 that renders as бЮ.╦unicode-tricksThe Egyptian hieroglyph A056 that renders as аЮ.╧unicode-tricksThe Egyptian hieroglyph A055 that renders as юЮ.╨unicode-tricksThe Egyptian hieroglyph A054 that renders as ©Ю.╩unicode-tricksThe Egyptian hieroglyph A053 that renders as ЎЮ.╪unicode-tricksThe Egyptian hieroglyph A052 that renders as ҐЮ.Ґunicode-tricksThe Egyptian hieroglyph A051 that renders as ╪Ю.Ўunicode-tricksThe Egyptian hieroglyph A050 that renders as ╩Ю.©unicode-tricksThe Egyptian hieroglyph A049 that renders as ╨Ю.юunicode-tricksThe Egyptian hieroglyph A048 that renders as ╧Ю.аunicode-tricksThe Egyptian hieroglyph A047 that renders as ╦Ю.бunicode-tricksThe Egyptian hieroglyph A046 that renders as ЇЮ.цunicode-tricksThe Egyptian hieroglyph A045A that renders as ІЮ.дunicode-tricksThe Egyptian hieroglyph A045 that renders as ╣Ю.еunicode-tricksThe Egyptian hieroglyph A044 that renders as ЄЮ.фunicode-tricksThe Egyptian hieroglyph A043A that renders as ЁЮ.гunicode-tricksThe Egyptian hieroglyph A043 that renders as ╡Ю.хunicode-tricksThe Egyptian hieroglyph A042A that renders as ╠Ю.иunicode-tricksThe Egyptian hieroglyph A042 that renders as ╟Ю.йunicode-tricksThe Egyptian hieroglyph A041 that renders as ╞Ю.кunicode-tricksThe Egyptian hieroglyph A040A that renders as ўЮ.лunicode-tricksThe Egyptian hieroglyph A040 that renders as ґЮ.мunicode-tricksThe Egyptian hieroglyph A039 that renders as ╛Ю.нunicode-tricksThe Egyptian hieroglyph A038 that renders as ╚Ю.оunicode-tricksThe Egyptian hieroglyph A037 that renders as ╙Ю.пunicode-tricksThe Egyptian hieroglyph A036 that renders as ╘Ю.яunicode-tricksThe Egyptian hieroglyph A035 that renders as ╗Ю.рunicode-tricksThe Egyptian hieroglyph A034 that renders as їЮ.сunicode-tricksThe Egyptian hieroglyph A033 that renders as іЮ.тunicode-tricksThe Egyptian hieroglyph A032A that renders as ╔Ю.уunicode-tricksThe Egyptian hieroglyph A032 that renders as єЮ.жunicode-tricksThe Egyptian hieroglyph A031 that renders as ёЮ.вunicode-tricksThe Egyptian hieroglyph A030 that renders as ╒Ю.ьunicode-tricksThe Egyptian hieroglyph A029 that renders as ║Ю.ыunicode-tricksThe Egyptian hieroglyph A028 that renders as ═Ю.зunicode-tricksThe Egyptian hieroglyph A027 that renders as ÷Ю.шunicode-tricksThe Egyptian hieroglyph A026 that renders as ·Ю.эunicode-tricksThe Egyptian hieroglyph A025 that renders as ²Ю.щunicode-tricksThe Egyptian hieroglyph A024 that renders as °Ю.чunicode-tricksThe Egyptian hieroglyph A023 that renders as ⌡Ю.ъunicode-tricksThe Egyptian hieroglyph A022 that renders as Ю.Юunicode-tricksThe Egyptian hieroglyph A021 that renders as ≥Ю.Аunicode-tricksThe Egyptian hieroglyph A020 that renders as ≤Ю.Бunicode-tricksThe Egyptian hieroglyph A019 that renders as ≈Ю.Цunicode-tricksThe Egyptian hieroglyph A018 that renders as √Ю.Дunicode-tricksThe Egyptian hieroglyph A017A that renders as ∙Ю.Еunicode-tricksThe Egyptian hieroglyph A017 that renders as ■Ю.Фunicode-tricksThe Egyptian hieroglyph A016 that renders as ⌠Ю.Гunicode-tricksThe Egyptian hieroglyph A015 that renders as ▓Ю.Хunicode-tricksThe Egyptian hieroglyph A014A that renders as ▒Ю.Иunicode-tricksThe Egyptian hieroglyph A014 that renders as ░Ю.Йunicode-tricksThe Egyptian hieroglyph A013 that renders as ▐Ю.Кunicode-tricksThe Egyptian hieroglyph A012 that renders as ▌Ю.Лunicode-tricksThe Egyptian hieroglyph A011 that renders as █Ю.Мunicode-tricksThe Egyptian hieroglyph A010 that renders as ▄Ю.Нunicode-tricksThe Egyptian hieroglyph A009 that renders as ▀Ю.Оunicode-tricksThe Egyptian hieroglyph A008 that renders as ┼Ю.Пunicode-tricksThe Egyptian hieroglyph A007 that renders as ┴Ю.Яunicode-tricksThe Egyptian hieroglyph A006B that renders as ┬Ю.Рunicode-tricksThe Egyptian hieroglyph A006A that renders as ┤Ю.Сunicode-tricksThe Egyptian hieroglyph A006 that renders as ├Ю.Тunicode-tricksThe Egyptian hieroglyph A005A that renders as ┘Ю.Уunicode-tricksThe Egyptian hieroglyph A005 that renders as └Ю.Жunicode-tricksThe Egyptian hieroglyph A004 that renders as ┐Ю.Вunicode-tricksThe Egyptian hieroglyph A003 that renders as ┌Ю.Ьunicode-tricksThe Egyptian hieroglyph A002 that renders as │Ю.Ыunicode-tricksThe Egyptian hieroglyph A001 that renders as ─Ю.╞клмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫ╞ЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлк сA module to map alphanumerical characters to their equivalent in an enclosed forms.hapytexeu+gh@gmail.comexperimentalPOSIXSafe^Зunicode-tricksConvert the given number to a у0acter where the number is circled wrapped in a в . This works for numbers in the 0-20( range. For numbers outside this range ь is returned.Шunicode-tricksConvert the given number to a убacter where the number is circled. This works for numbers in the 0-20е range. For numbers outside this range, the behavior is unspecified.Эunicode-tricks+Convert the given upper case or lower case убacter to a character that is circled. The result is wrapped in a в0 data constructor. If the value is outside the A-Z,a-z range, ь is returned.Щunicode-tricks+Convert the given upper case or lower case уцacter to a character that is circled. If the value is outside the A-Z,a-z# range, the result is unspecified.Чunicode-tricksConvert the given number to a у6acter where the number is parenthesized wrapped in a в1 data constructor. If the number is outside the 1-20 range, ь is returned.Ъunicode-tricksConvert the given number to a угacter where the number is parenthesized. If the number is outside the 1-20# range, the result is unspecified.─unicode-tricksConvert the given number to a у2acter where the number is succeeded by a period (.) wrapped in a в1 data constructor. If the number is outside the 0-20 range, ь is returned.│unicode-tricksConvert the given number to у2acter where the number is succeeded by a period (. ). If the number is outside the 0-20# range, the result is unspecified.┌unicode-tricksConvert the given number to a уфacter where the number is double circled. The result is wrapped in a в7 data constructor. If the given number is outside the 1-10 range, ь is returned.┐unicode-tricksConvert the given number to a унacter where the number is double circled. If the given number is outside the 1-10# range, the result is unspecified.└unicode-tricksConvert the given number to a у1acter where the number is succeeded by a comma (,). The result is wrapped in a в7 data constructor. If the given number is outside the 0-9 range, ь is returned.┘unicode-tricksConvert the given number to a у1acter where the number is succeeded by a comma (,&). If the given number is outside the 0-9# range, the result is unspecified.├unicode-tricks+Convert the given upper case or lower case уacter to a у=acter where it is parenthesized. The result is wrapped in a в0 data constructor. If the value is outside the A-Z,a-z range, ь is returned.┤unicode-tricks:Convert the given upper case or lower case character to a у>acter where it is parenthesized. If the value is outside the A-Z,a-z# range, the result is unspecified.┬unicode-tricks,Convert the given upper case character to a умacter where it is squared (put in a square box). The result is wrapped in a в0 data constructor. If the value is outside the A-Z range, ь is returned.┴unicode-tricks,Convert the given upper case character to a унacter where it is squared (put in a square box). If the value is outside the A-Z# range, the result is unspecified.┼unicode-tricks█Convert the given upper case character to a character where the character is written in white on a black circle. The result is wrapped in a в6 data constructor. If the given value is outside the A-Z range, ь is returned.▀unicode-tricks∙Convert the given upper case character to a character where the character is written in white on a black circle. If the given value is outside the A-Z" range, the result is unspecified.▄unicode-tricks█Convert the given upper case character to a character where the character is written in white on a black square. The result is wrapped in a в6 data constructor. If the given value is outside the A-Z range, ь is returned.█unicode-tricks∙Convert the given upper case character to a character where the character is written in white on a black square. If the given value is outside the A-Z" range, the result is unspecified.▌unicode-tricksЭConvert the given number to a character where the number is written in white on a black circle. The result is wrapped in a в6 data constructor. If the given value is outside the 0,11-20 range, ь is returned.▐unicode-tricks┐Convert the given number to a character where the number is written in white on a black circle. If the given value is outside the 0,11-20# range, the result is unspecified.░unicode-tricksФConvert the given upper case character to a regional indicator character. The result is wrapped in a в0 data constructor. If the value is outside the A-Z range, ь┐ is returned. The regional indicators are used for flag emojis. Two consecutive regional indicators that together form an ISO 63166 Alpha-2 code, then this will result in the corresponding flag Emoji. Deprecated countries like the Soviet Union (SU) and Yugoslavia (YU) do not have a flag emoji. Antarctica (AQ), the European Union (EU) and the United Nations (UN) have a flag emoji.▒unicode-tricksГConvert the given upper case character to a regional indicator character. If the value is outside the A-Z" range, the result is unspecified.ТThe regional indicators are used for flag emojis. Two consecutive regional indicators that together form an ISO 63166 Alpha-2 code, then this will result in the corresponding flag Emoji. Deprecated countries like the Soviet Union (SU) and Yugoslavia (YU) do not have a flag emoji. Antarctica (AQ), the European Union (EU) and the United Nations (UN) have a flag emoji.Зunicode-tricksThe given number to convert.unicode-tricksA у?acter that is circled variant of the given number wrapped in a в data constructor if it exists; ь otherwise.Шunicode-tricksThe given number to convert.unicode-tricks field that contains the given hours between 0 and 12, and a ╦ field that if ы/, means that the clock is half past that hour.Їunicode-tricksхThe number of hours on the given clock. Is between 0 and 12. For 0, the ╦ is ы; and for 12, the ╦ is з.╦unicode-tricksIs ы* if it is half past the given hour on the І.╧unicode-tricksюA data type to store a subregion flag. This is specified by the parentД flag, and three characters of the subregion. At the moment, the only three subregional flags are England (eng), Scotland (sct) and Wales (wls), all beloning under the United Kingdomз flag (GB). The data constructor is made private to prevent making non-existing subflags.╨unicode-tricksкA data type that stores a (country) flag by the two characters of the ISO 3166 Alpa-2 standard. The data constructor is hidden to prevent making flags with a combination of characters that is invalid. Besides the countries defined in the ISO-3166 Alpha-2 standard, only the Antarctica (AQ), the European Union (EU) and the United Nations (UN) have a flag. Deprecated territories like the Soviet Union (SU) and Yugoslavia (YU) have no corresponding flag.╩unicode-tricksThe English name for the ї zodiac sign.╪unicode-tricksThe English name for the і zodiac sign.Ґunicode-tricksAn English name for the ╔ zodiac sign.Ўunicode-tricksAn English name for the ╔ zodiac sign.©unicode-tricksAn English name for the ╔ zodiac sign.юunicode-tricks%The name of the constellation of the ╔ zodiac sign.аunicode-tricksAn English name for the є zodiac sign.бunicode-tricksAn English name for the є zodiac sign.цunicode-tricksThe English name for the ё zodiac sign.дunicode-tricks%The name of the constellation of the ё zodiac sign.еunicode-tricksThe English name for the ╒ zodiac sign.фunicode-tricksThe English name for the ║ zodiac sign.гunicode-tricksThe English name for the ═ zodiac sign.хunicode-tricksThe English name for the ÷ zodiac sign.иunicode-tricksThe English name for the · zodiac sign.йunicode-tricksThe English name for the ² zodiac sign.кunicode-tricksThe English name for the ° zodiac sign.лunicode-tricksThe ╗: that corresponds to type six of the /Fitzpatrick scale/.мunicode-tricksThe ╗; that corresponds to type five of the /Fitzpatrick scale/.нunicode-tricksThe ╗; that corresponds to type four of the /Fitzpatrick scale/.оunicode-tricksThe ╗< that corresponds to type three of the /Fitzpatrick scale/.пunicode-tricksThe ╗: that corresponds to type two of the /Fitzpatrick scale/.яunicode-tricksThe ╗: that corresponds to type one of the /Fitzpatrick scale/.рunicode-tricksThe ╧ pattern use for Wales denoted with GB-WLS or WLS.сunicode-tricksThe ╧ pattern use for Scotland denoted with GB-SCT or SCT.тunicode-tricksThe ╧ pattern use for England denoted with GB-ENG or ENG.уunicode-tricksThe ╨ pattern used for Zimbabwe denoted with ZW.жunicode-tricksThe ╨ pattern used for Zambia denoted with ZM.вunicode-tricksThe ╨ pattern used for South Africa denoted with ZA.ьunicode-tricksThe ╨ pattern used for Mayotte denoted with YT.ыunicode-tricksThe ╨ pattern used for Yemen denoted with YE.зunicode-tricksThe ╨ pattern used for Kosovo denoted with XK.шunicode-tricksThe ╨ pattern used for Samoa denoted with WS.эunicode-tricksThe ╨ pattern used for Wallis & Futuna denoted with WF.щunicode-tricksThe ╨ pattern used for Vanuatu denoted with VU.чunicode-tricksThe ╨ pattern used for Vietnam denoted with VN.ъunicode-tricksThe ╨ pattern used for the U.S. Virgin Islands denoted with VI.Юunicode-tricksThe ╨ pattern used for the British Virgin Islands denoted with VG.Аunicode-tricksThe ╨ pattern used for Venezuela denoted with VE.Бunicode-tricksThe ╨ pattern used for St. Vincent & Grenadines denoted with VC.Цunicode-tricksThe ╨ pattern used for Vatican City denoted with VA.Дunicode-tricksThe ╨ pattern used for Uzbekistan denoted with UZ.Еunicode-tricksThe ╨ pattern used for Uruguay denoted with UY.Фunicode-tricksThe ╨ pattern used for the United States denoted with US.Гunicode-tricksThe ╨ pattern used for the United Nations denoted with UN.Хunicode-tricksThe ╨ pattern used for the U.S. Outlying Islands denoted with UM.Иunicode-tricksThe ╨ pattern used for Uganda denoted with UG.Йunicode-tricksThe ╨ pattern used for Ukraine denoted with UA.Кunicode-tricksThe ╨ pattern used for Tanzania denoted with TZ.Лunicode-tricksThe ╨ pattern used for Taiwan denoted with TW.Мunicode-tricksThe ╨ pattern used for Tuvalu denoted with TV.Нunicode-tricksThe ╨ pattern used for Trinidad & Tobago denoted with TT.Оunicode-tricksThe ╨ pattern used for Turkey denoted with TR.Пunicode-tricksThe ╨ pattern used for Tonga denoted with TO.Яunicode-tricksThe ╨ pattern used for Tunisia denoted with TN.Рunicode-tricksThe ╨ pattern used for Turkmenistan denoted with TM.Сunicode-tricksThe ╨ pattern used for Timor-Leste denoted with TL.Тunicode-tricksThe ╨ pattern used for Tokelau denoted with TK.Уunicode-tricksThe ╨ pattern used for Tajikistan denoted with TJ.Жunicode-tricksThe ╨ pattern used for Thailand denoted with TH.Вunicode-tricksThe ╨ pattern used for Togo denoted with TG.Ьunicode-tricksThe ╨ pattern used for the French Southern Territories denoted with TF.Ыunicode-tricksThe ╨ pattern used for Chad denoted with TD.Зunicode-tricksThe ╨ pattern used for the Turks & Caicos Islands denoted with TC.Шunicode-tricksThe ╨ pattern used for Tristan da Cunha denoted with TA.Эunicode-tricksThe ╨ pattern used for Eswatini denoted with SZ.Щunicode-tricksThe ╨ pattern used for Syria denoted with SY.Чunicode-tricksThe ╨ pattern used for Sint Maarten denoted with SX.Ъunicode-tricksThe ╨ pattern used for El Salvador denoted with SV.─unicode-tricksThe ╨ pattern used for SЦo TomИ & PrМncipe denoted with ST.│unicode-tricksThe ╨ pattern used for South Sudan denoted with SS.┌unicode-tricksThe ╨ pattern used for Suriname denoted with SR.┐unicode-tricksThe ╨ pattern used for Somalia denoted with SO.└unicode-tricksThe ╨ pattern used for Senegal denoted with SN.┘unicode-tricksThe ╨ pattern used for San Marino denoted with SM.├unicode-tricksThe ╨ pattern used for Sierra Leone denoted with SL.┤unicode-tricksThe ╨ pattern used for Slovakia denoted with SK.┬unicode-tricksThe ╨ pattern used for Svalbard & Jan Mayen denoted with SJ.┴unicode-tricksThe ╨ pattern used for Slovenia denoted with SI.┼unicode-tricksThe ╨ pattern used for St. Helena denoted with SH.▀unicode-tricksThe ╨ pattern used for Singapore denoted with SG.▄unicode-tricksThe ╨ pattern used for Sweden denoted with SE.█unicode-tricksThe ╨ pattern used for Sudan denoted with SD.▌unicode-tricksThe ╨ pattern used for Seychelles denoted with SC.▐unicode-tricksThe ╨ pattern used for the Solomon Islands denoted with SB.░unicode-tricksThe ╨ pattern used for Saudi Arabia denoted with SA.▒unicode-tricksThe ╨ pattern used for Rwanda denoted with RW.▓unicode-tricksThe ╨ pattern used for Russia denoted with RU.⌠unicode-tricksThe ╨ pattern used for Serbia denoted with RS.■unicode-tricksThe ╨ pattern used for Romania denoted with RO.∙unicode-tricksThe ╨ pattern used for RИunion denoted with RE.√unicode-tricksThe ╨ pattern used for Qatar denoted with QA.≈unicode-tricksThe ╨ pattern used for Paraguay denoted with PY.≤unicode-tricksThe ╨ pattern used for Palau denoted with PW.≥unicode-tricksThe ╨ pattern used for Portugal denoted with PT. unicode-tricksThe ╨ pattern used for the Palestinian Territories denoted with PS.⌡unicode-tricksThe ╨ pattern used for Puerto Rico denoted with PR.°unicode-tricksThe ╨ pattern used for the Pitcairn Islands denoted with PN.²unicode-tricksThe ╨ pattern used for St. Pierre & Miquelon denoted with PM.·unicode-tricksThe ╨ pattern used for Poland denoted with PL.÷unicode-tricksThe ╨ pattern used for Pakistan denoted with PK.═unicode-tricksThe ╨ pattern used for the Philippines denoted with PH.║unicode-tricksThe ╨ pattern used for Papua New Guinea denoted with PG.╒unicode-tricksThe ╨ pattern used for French Polynesia denoted with PF.ёunicode-tricksThe ╨ pattern used for Peru denoted with PE.єunicode-tricksThe ╨ pattern used for Panama denoted with PA.╔unicode-tricksThe ╨ pattern used for Oman denoted with OM.іunicode-tricksThe ╨ pattern used for New Zealand denoted with NZ.їunicode-tricksThe ╨ pattern used for Niue denoted with NU.╗unicode-tricksThe ╨ pattern used for Nauru denoted with NR.╘unicode-tricksThe ╨ pattern used for Nepal denoted with NP.╙unicode-tricksThe ╨ pattern used for Norway denoted with NO.╚unicode-tricksThe ╨ pattern used for the Netherlands denoted with NL.╛unicode-tricksThe ╨ pattern used for Nicaragua denoted with NI.ґunicode-tricksThe ╨ pattern used for Nigeria denoted with NG.ўunicode-tricksThe ╨ pattern used for Norfolk Island denoted with NF.╞unicode-tricksThe ╨ pattern used for Niger denoted with NE.╟unicode-tricksThe ╨ pattern used for New Caledonia denoted with NC.╠unicode-tricksThe ╨ pattern used for Namibia denoted with NA.╡unicode-tricksThe ╨ pattern used for Mozambique denoted with MZ.Ёunicode-tricksThe ╨ pattern used for Malaysia denoted with MY.Єunicode-tricksThe ╨ pattern used for Mexico denoted with MX.╣unicode-tricksThe ╨ pattern used for Malawi denoted with MW.Іunicode-tricksThe ╨ pattern used for the Maldives denoted with MV.Їunicode-tricksThe ╨ pattern used for Mauritius denoted with MU.╦unicode-tricksThe ╨ pattern used for Malta denoted with MT.╧unicode-tricksThe ╨ pattern used for Montserrat denoted with MS.╨unicode-tricksThe ╨ pattern used for Mauritania denoted with MR.╩unicode-tricksThe ╨ pattern used for Martinique denoted with MQ.╪unicode-tricksThe ╨ pattern used for the Northern Mariana Islands denoted with MP.Ґunicode-tricksThe ╨ pattern used for Macao SAR China denoted with MO.Ўunicode-tricksThe ╨ pattern used for Mongolia denoted with MN.©unicode-tricksThe ╨ pattern used for Myanmar (Burma) denoted with MM.юunicode-tricksThe ╨ pattern used for Mali denoted with ML.аunicode-tricksThe ╨ pattern used for North Macedonia denoted with MK.бunicode-tricksThe ╨ pattern used for the Marshall Islands denoted with MH.цunicode-tricksThe ╨ pattern used for Madagascar denoted with MG.дunicode-tricksThe ╨ pattern used for St. Martin denoted with MF.еunicode-tricksThe ╨ pattern used for Montenegro denoted with ME.фunicode-tricksThe ╨ pattern used for Moldova denoted with MD.гunicode-tricksThe ╨ pattern used for Monaco denoted with MC.хunicode-tricksThe ╨ pattern used for Morocco denoted with MA.иunicode-tricksThe ╨ pattern used for Libya denoted with LY.йunicode-tricksThe ╨ pattern used for Latvia denoted with LV.кunicode-tricksThe ╨ pattern used for Luxembourg denoted with LU.лunicode-tricksThe ╨ pattern used for Lithuania denoted with LT.мunicode-tricksThe ╨ pattern used for Lesotho denoted with LS.нunicode-tricksThe ╨ pattern used for Liberia denoted with LR.оunicode-tricksThe ╨ pattern used for Sri Lanka denoted with LK.пunicode-tricksThe ╨ pattern used for Liechtenstein denoted with LI.яunicode-tricksThe ╨ pattern used for St. Lucia denoted with LC.рunicode-tricksThe ╨ pattern used for Lebanon denoted with LB.сunicode-tricksThe ╨ pattern used for Laos denoted with LA.тunicode-tricksThe ╨ pattern used for Kazakhstan denoted with KZ.уunicode-tricksThe ╨ pattern used for the Cayman Islands denoted with KY.жunicode-tricksThe ╨ pattern used for Kuwait denoted with KW.вunicode-tricksThe ╨ pattern used for South Korea denoted with KR.ьunicode-tricksThe ╨ pattern used for North Korea denoted with KP.ыunicode-tricksThe ╨ pattern used for St. Kitts & Nevis denoted with KN.зunicode-tricksThe ╨ pattern used for the Comoros denoted with KM.шunicode-tricksThe ╨ pattern used for Kiribati denoted with KI.эunicode-tricksThe ╨ pattern used for Cambodia denoted with KH.щunicode-tricksThe ╨ pattern used for Kyrgyzstan denoted with KG.чunicode-tricksThe ╨ pattern used for Kenya denoted with KE.ъunicode-tricksThe ╨ pattern used for Japan denoted with JP.Юunicode-tricksThe ╨ pattern used for Jordan denoted with JO.Аunicode-tricksThe ╨ pattern used for Jamaica denoted with JM.Бunicode-tricksThe ╨ pattern used for Jersey denoted with JE.Цunicode-tricksThe ╨ pattern used for Italy denoted with IT.Дunicode-tricksThe ╨ pattern used for Iceland denoted with IS.Еunicode-tricksThe ╨ pattern used for Iran denoted with IR.Фunicode-tricksThe ╨ pattern used for Iraq denoted with IQ.Гunicode-tricksThe ╨ pattern used for British Indian Ocean Territory denoted with IO.Хunicode-tricksThe ╨ pattern used for India denoted with IN.Иunicode-tricksThe ╨ pattern used for Isle of Man denoted with IM.Йunicode-tricksThe ╨ pattern used for Israel denoted with IL.Кunicode-tricksThe ╨ pattern used for Ireland denoted with IE.Лunicode-tricksThe ╨ pattern used for Indonesia denoted with ID.Мunicode-tricksThe ╨ pattern used for the Canary Islands denoted with IC.Нunicode-tricksThe ╨ pattern used for Hungary denoted with HU.Оunicode-tricksThe ╨ pattern used for Haiti denoted with HT.Пunicode-tricksThe ╨ pattern used for Croatia denoted with HR.Яunicode-tricksThe ╨ pattern used for Honduras denoted with HN.Рunicode-tricksThe ╨ pattern used for the Heard & McDonald Islands denoted with HM.Сunicode-tricksThe ╨ pattern used for Hong Kong SAR China denoted with HK.Тunicode-tricksThe ╨ pattern used for Guyana denoted with GY.Уunicode-tricksThe ╨ pattern used for Guinea-Bissau denoted with GW.Жunicode-tricksThe ╨ pattern used for Guam denoted with GU.Вunicode-tricksThe ╨ pattern used for Guatemala denoted with GT.Ьunicode-tricksThe ╨ pattern used for the &South Georgia & South Sandwich Islands denoted with GS.Ыunicode-tricksThe ╨ pattern used for Greece denoted with GR.Зunicode-tricksThe ╨ pattern used for Equatorial Guinea denoted with GQ.Шunicode-tricksThe ╨ pattern used for Guadeloupe denoted with GP.Эunicode-tricksThe ╨ pattern used for Guinea denoted with GN.Щunicode-tricksThe ╨ pattern used for Gambia denoted with GM.Чunicode-tricksThe ╨ pattern used for Greenland denoted with GL.Ъunicode-tricksThe ╨ pattern used for Gibraltar denoted with GI.─unicode-tricksThe ╨ pattern used for Ghana denoted with GH.│unicode-tricksThe ╨ pattern used for Guernsey denoted with GG.┌unicode-tricksThe ╨ pattern used for French Guiana denoted with GF.┐unicode-tricksThe ╨ pattern used for Georgia denoted with GE.└unicode-tricksThe ╨ pattern used for Grenada denoted with GD.┘unicode-tricksThe ╨ pattern used for United Kingdom denoted with GB.├unicode-tricksThe ╨ pattern used for Gabon denoted with GA.┤unicode-tricksThe ╨ pattern used for France denoted with FR.┬unicode-tricksThe ╨ pattern used for the Faroe Islands denoted with FO.┴unicode-tricksThe ╨ pattern used for Micronesia denoted with FM.┼unicode-tricksThe ╨ pattern used for the Falkland Islands denoted with FK.▀unicode-tricksThe ╨ pattern used for Fiji denoted with FJ.▄unicode-tricksThe ╨ pattern used for Finland denoted with FI.█unicode-tricksThe ╨ pattern used for the European Union denoted with EU.▌unicode-tricksThe ╨ pattern used for Ethiopia denoted with ET.▐unicode-tricksThe ╨ pattern used for Spain denoted with ES.░unicode-tricksThe ╨ pattern used for Eritrea denoted with ER.▒unicode-tricksThe ╨ pattern used for Western Sahara denoted with EH.▓unicode-tricksThe ╨ pattern used for Egypt denoted with EG.⌠unicode-tricksThe ╨ pattern used for Estonia denoted with EE.■unicode-tricksThe ╨ pattern used for Ecuador denoted with EC.∙unicode-tricksThe ╨ pattern used for Ceuta & Melilla denoted with EA.√unicode-tricksThe ╨ pattern used for Algeria denoted with DZ.≈unicode-tricksThe ╨ pattern used for Dominican Republic denoted with DO.≤unicode-tricksThe ╨ pattern used for Dominica denoted with DM.≥unicode-tricksThe ╨ pattern used for Denmark denoted with DK. unicode-tricksThe ╨ pattern used for Djibouti denoted with DJ.⌡unicode-tricksThe ╨ pattern used for Diego Garcia denoted with DG.°unicode-tricksThe ╨ pattern used for Germany denoted with DE.²unicode-tricksThe ╨ pattern used for Czechia denoted with CZ.·unicode-tricksThe ╨ pattern used for Cyprus denoted with CY.÷unicode-tricksThe ╨ pattern used for Christmas Island denoted with CX.═unicode-tricksThe ╨ pattern used for CuraГao denoted with CW.║unicode-tricksThe ╨ pattern used for Cape Verde denoted with CV.╒unicode-tricksThe ╨ pattern used for Cuba denoted with CU.ёunicode-tricksThe ╨ pattern used for Costa Rica denoted with CR.єunicode-tricksThe ╨ pattern used for Clipperton Island denoted with CP.╔unicode-tricksThe ╨ pattern used for Colombia denoted with CO.іunicode-tricksThe ╨ pattern used for China denoted with CN.їunicode-tricksThe ╨ pattern used for Cameroon denoted with CM.╗unicode-tricksThe ╨ pattern used for Chile denoted with CL.╘unicode-tricksThe ╨ pattern used for the Cook Islands denoted with CK.╙unicode-tricksThe ╨ pattern used for CТte d≥@Ivoire denoted with CI.╚unicode-tricksThe ╨ pattern used for Switzerland denoted with CH.╛unicode-tricksThe ╨ pattern used for Congo - Brazzaville denoted with CG.ґunicode-tricksThe ╨ pattern used for Central African Republic denoted with CF.ўunicode-tricksThe ╨ pattern used for Congo - Kinshasa denoted with CD.╞unicode-tricksThe ╨ pattern used for the Cocos (Keeling) Islands denoted with CC.╟unicode-tricksThe ╨ pattern used for Canada denoted with CA.╠unicode-tricksThe ╨ pattern used for Belize denoted with BZ.╡unicode-tricksThe ╨ pattern used for Belarus denoted with BY.Ёunicode-tricksThe ╨ pattern used for Botswana denoted with BW.Єunicode-tricksThe ╨ pattern used for Bouvet Island denoted with BV.╣unicode-tricksThe ╨ pattern used for Bhutan denoted with BT.Іunicode-tricksThe ╨ pattern used for the Bahamas denoted with BS.Їunicode-tricksThe ╨ pattern used for Brazil denoted with BR.╦unicode-tricksThe ╨ pattern used for the Caribbean Netherlands denoted with BQ.╧unicode-tricksThe ╨ pattern used for Bolivia denoted with BO.╨unicode-tricksThe ╨ pattern used for Brunei denoted with BN.╩unicode-tricksThe ╨ pattern used for Bermuda denoted with BM.╪unicode-tricksThe ╨ pattern used for St. BarthИlemy denoted with BL.Ґunicode-tricksThe ╨ pattern used for Benin denoted with BJ.Ўunicode-tricksThe ╨ pattern used for Burundi denoted with BI.©unicode-tricksThe ╨ pattern used for Bahrain denoted with BH.юunicode-tricksThe ╨ pattern used for Bulgaria denoted with BG.аunicode-tricksThe ╨ pattern used for Burkina Faso denoted with BF.бunicode-tricksThe ╨ pattern used for Belgium denoted with BE.цunicode-tricksThe ╨ pattern used for Bangladesh denoted with BD.дunicode-tricksThe ╨ pattern used for Barbados denoted with BB.еunicode-tricksThe ╨ pattern used for Bosnia & Herzegovina denoted with BA.фunicode-tricksThe ╨ pattern used for Azerbaijan denoted with AZ.гunicode-tricksThe ╨ pattern used for the еland Islands denoted with AX.хunicode-tricksThe ╨ pattern used for Aruba denoted with AW.иunicode-tricksThe ╨ pattern used for Australia denoted with AU.йunicode-tricksThe ╨ pattern used for Austria denoted with AT.кunicode-tricksThe ╨ pattern used for American Samoa denoted with AS.лunicode-tricksThe ╨ pattern used for Argentina denoted with AR.мunicode-tricksThe ╨ pattern used for Antarctica denoted with AQ.нunicode-tricksThe ╨ pattern used for Angola denoted with AO.оunicode-tricksThe ╨ pattern used for Armenia denoted with AM.пunicode-tricksThe ╨ pattern used for Albania denoted with AL.яunicode-tricksThe ╨ pattern used for Anguilla denoted with AI.рunicode-tricksThe ╨ pattern used for Antigua & Barbuda denoted with AG.сunicode-tricksThe ╨ pattern used for Afghanistan denoted with AF.тunicode-tricksThe ╨ pattern used for the United Arab Emirates denoted with AE.уunicode-tricksThe ╨ pattern used for Andorra denoted with AD.жunicode-tricksThe ╨ pattern used for Ascension Island denoted with AC.вunicode-tricksA ухacter that is often used as a suffix to turn a character into an emoji.ьunicode-tricksХConvert the given two characters that represent a flag according to the ISO 3166 Alpha-2 standard to a ╨ wrapped in a в) data constructor, if that flag exists; ь4 otherwise. One can pass characters in upper case (A-Z) and lower case (a-zю). The flag will hold the upper case variant. The Emoji have flags for the countries defined by the ISO 3166 Alpha-2 standard without deprecated regions like the Soviet Union (SU) and Yugoslavia (YU). Furthermore there are Emoji for the flags of Antarctica (AQ), the European Union (EU) and the United Nations (UN).ыunicode-tricksХConvert the given two characters that represent a flag according to the ISO 3166 Alpha-2 standard to a ╨Х. If the flag does not exists, then the result is unspecified. One can pass characters in upper case (A-Z) and lower case (a-zю). The flag will hold the upper case variant. The Emoji have flags for the countries defined by the ISO 3166 Alpha-2 standard without deprecated regions like the Soviet Union (SU) and Yugoslavia (YU). Furthermore there are Emoji for the flags of Antarctica (AQ), the European Union (EU) and the United Nations (UN).зunicode-tricks1Obtain the two-characters that specify the given ╨/. These two characters are always upper case (A-Z).шunicode-tricks Generate the І< object that is the closest to the given hours and minutes.эunicode-tricksConstruct a І. object with the given number of hours, and a Цхean that indicates if it is half past that hour. The function will ensure that the hours are between 0 and 12 (both inclusive). For half past 12, we use half past 0, for 12 hours, we use simply 12.щunicode-tricksConvert the given Fitzpatrick skin type to the corresponding ╗ wrapped in a в , if no such ╗ exists, ь is returned.чunicode-tricksConvert the given two уЩacters of the ISO3166-1 Alpha-2 standard to an Emoji that renders the flag of the corresponding country or terroitory. Deprecated regions, such as SU (Soviet Union) and YU (Yugoslavia) have no flag. The European Union (EU), Antarctica (AQ) and United Nations (UN) are included as marcoregion flags. This function does not check if the two characters map to a valid flag token.ъunicode-tricksConvert the given two у┘acters of the ISO3166-1 Alpha-2 standard to an Emoji that renders the flag of the corresponding country or terroitory wrapped in a вГ data constructor. Deprecated regions, such as SU (Soviet Union) and YU (Yugoslavia) have no flag. The European Union (EU), Antarctica (AQ) and United Nations (UN) are included as marcoregion flags. If the flag does not exists, ь is returned.Юunicode-tricksCheck if for the given two у╧acters, a flag emoji exists. The two character combinations for which a flag exist are defined in the ISO3166-1 Alpha-2 standard where deprecated reagions, such as SU and YU have no flag, and the European Union (EU), Antarctica (AQ), and the United Nations (UN) have a flag. The characters can be upper case (A-Z) or lower case (a-z). ьunicode-tricks5The first character of the ISO 3166 Alpha-2 standard.unicode-tricks6The second character of the ISO 3166 Alpha-2 standard.unicode-tricksA ╨ object wrapped in a в+ data constructor, given such flag exists; ь otherwise.ыunicode-tricks5The first character of the ISO 3166 Alpha-2 standard.unicode-tricks6The second character of the ISO 3166 Alpha-2 standard.unicode-tricksThe equivalent ╨ object.зunicode-tricks The given ╨ to convert to a 2-tuple of уacters.unicode-tricks#A 2-tuple that contains upper case уacters for the given ╨.шunicode-tricksThe number of hours.unicode-tricks0The number of minutes, must be between 0 and 60.unicode-tricksдThe clock object that is the closest to the given hours and minutes.эunicode-tricksпThe given hour of the clock, can be any value, but will be set between 1 and 12.unicode-tricksA Ц4ean that indicates if it is half past that hour, so ы means we add 30 minutes.unicode-tricksлA clock object that represents the time that is passed through an hour and .щunicode-tricks The given Fitzpatrick skin type.unicode-tricksThe corresponding ╗ wrapped in a в; ь if no such modifier exists.чunicode-tricks The first у"acter of the ISO3166 Alpha-2 code.unicode-tricksThe second у"acter of the ISO3166 Alpha-2 code.unicode-tricksA шН object that consists of two characters, where the two characters form a flag emoji, if the given flag exists.ъunicode-tricks The first у"acter of the ISO3166 Alpha-2 code.unicode-tricksThe second у"acter of the ISO3166 Alpha-2 code.unicode-tricksA шА object that consists of two characters, where the two characters form a flag emoji wrapped in a в, if the given flag exists; ь otherwise.Юunicode-tricks The first у"acter of the ISO3166 Alpha-2 code.unicode-tricksThe second у"acter of the ISO3166 Alpha-2 code.unicode-tricksы2 if a flag emoji exists for the given characters; з otherwise.о▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮов╨ьызъчЮ╧ІЇ╦эш╠╡ЁЄ╣▓⌠■∙√≈≤≥ ў╞╟⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґщжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсряпонмлкйихгфедцбаю©ЎҐ╪╩╨╧╦ЇІ╣ЄЁ╡╠╟╞ўґ╛╚╙╘╗їі╔єё╒║═÷·²°⌡ ≥≤≈√∙■⌠▓▒░▐▌█▄▀┼┴┬┤├┘└┐┌│─ЪЧЩЭШЗЫЬВЖУТСРЯПОНМЛКЙИХГФЕДЦБАЮъчщэшзыьвжутсркйихгфедцбаю©ЎҐ╪╩японмл:A module used to render frames with light and heavy lines.hapytexeu+gh@gmail.comexperimentalPOSIXSafe567>юХГёunicode-tricks The given character to convert to its superscript counterpart.unicode-tricksA character wrapped in a в given the counterpart exists, ь otherwise.лunicode-tricks?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[[\]^_`abcdeffghijklmnnopqrstuvwxyz{|}~─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─ │ ┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш э щ ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Щ Ч Ъ ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшзэщщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУ║═ЖВЬЫЗШЭЩЧЪ─ │ °≥≤┌ ┐ └ ┘ ├ ┤ ┬ ┴ ┼ ▀ ▄ █ ▌ ▐ ░ ▒ ▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д е ф г х и й к л м н о п я р с т у ж в ь ы з ш ш э щ ч ч ъ Ю А Б Ц Д Е Ф Г Х И Й К Л М Н О П Я Р С Т У Ж В Ь Ы З Ш Э Э Щ Ч Ъ ─││┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє ╔ і ї ╗ ╘ ╙ ╚ ╛ ґ ў ╞ ╟ ╠ ╡ Ё Є ╣ І Ї ╦ ╧ ╨ ╩ ╪ Ґ Ў © ю а б ц д ефгхиишйклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓ ⌠ ■ ∙ √ ≈ ≤ ≥ ⌡ ° ² · ÷ ═ ║ ╒ ё є ╔ і ї ╗ ╘ ╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВ╨ЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐібЎ©©ssюаrrъ Ю бцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡°²·÷═║╒ёє╔ії╗╘╙╚╛ґў╞╟╠╡ЁЄ╣ІЇ╦╧╨╩╪ҐЎ©юабцдефгхийклмнопярстужвьызшэщчъЮАБЦДЕФГХИЙКЛМНОПЯРСТУЖВ╣ІЇ╦╧╨ЬЫЗШЭЩЧЪ─│┌┐└┘├┤┬┴┼▀▄█▌▐░▒▓⌠■∙√≈≤≥ ⌡° ² ·!÷!═!║!╒"ё"м"л"є"─"╔"і"ї"╣"╗"Ч"│"╘"╙"к"╚"╛"ґ"ў"╞"╟"╠"╡"╧"Ё"Є"╣"І"Ї"╦"╧"╨"╩"╪"Ґ"Ў"©"ю"а"б"ц"д"е"ф"г"х"и"й"к#л#м#н#о#п#я#р#с#т#ужвьызш&эщ&эчжвъжвЮАБЦДЕФДЕГ&ХИ&ХЙ&ХК&ХЛ&МНжвО&эП%Я%Р%С%Т%У%Ж%В%ЬЫЗШ&МЭЩ-unicode-tricks-0.9.1.0-BTmL1LynEZsHnSRxjnyDW7Data.Char.ControlData.Char.CoreData.Char.BracketsData.Char.CombiningData.Char.ChessData.Char.CardData.Char.BlockData.Char.BrailleData.Char.BallotBoxData.Char.DiceData.Char.DominoData.Char.EgyptianData.Char.EnclosedData.Char.EmojiData.Char.FrameData.Char.Math.FrakturData.Char.Math.DoubleStruckData.Char.Math.MonospaceData.Char.Math.SansSerif.DigitData.Char.Math.SansSerif.GreekData.Char.Math.SansSerif.LatinData.Char.Math.SansSerifData.Char.Math.ScriptData.Char.Math.Serif.DigitData.Char.Math.Serif.GreekData.Char.Math.Serif.LatinData.Char.Math.SerifData.Char.MathData.Char.Number.DuodecimalData.Char.Number.EgyptianData.Char.Number.RomanData.Char.Number.SegmentedData.Char.PrivateData.Char.Private.KlingonData.Char.SmallData.Char.InternalData.Char.Math.InternalbaseGHC.Unicode isControl isAlphaNumisAlphaisAsciiGHC.CharchrGHC.BaseordBracketTypeOpenClosebracketMapsbracketsopenBrackets closeBracketstoClosetoOpen isBracket isOpenBracketisCloseBracketbracketTypebracketType'getOppositeChargetOppositeChar'$fArbitraryBracketType$fBoundedBracketType$fEnumBracketType$fEqBracketType$fOrdBracketType$fReadBracketType$fShowBracketTypeisAsciiControlhasControlVisualizationblankSymbolopenBoxnewLinealternativeDeletealternativeSubstitutecontrolPicturecontrolPicture'fromControlPicturefromControlPicture'UnicodeText toUnicodeTextfromUnicodeTextfromUnicodeText'UnicodeCharacter toUnicodeCharfromUnicodeCharfromUnicodeChar'UnicodeCharLigateNoLigate FontStyle SansSerifSerif ItalicTypeNoItalicItalicEmphasisNoBoldBoldRotatedrobjectrotationRotate90R0R90R180R270OrientedoobjectorientationOrientation HorizontalVertical PlusStyleWithoutPlusWithPlus LetterCase UpperCase LowerCasesplitLetterCasesplitPlusStyle splitEmphasissplitItalicTypesplitFontStylesplitLigateligateligateFisAsciiAlphaisAsciiAlphaNumisGreekwithSignsignValueSystempositionalNumberSystempositionalNumberSystem10 isNotReserved isReservedisACharacterisNotACharacter mapToEnum mapToEnumSafemapFromEnumliftNumberFromliftNumberFrom' liftNumberliftNumber' liftDigit liftDigit' liftUppercaseliftUppercase' liftLowercaseliftLowercase'liftUpperLowercaseliftUpperLowercase'$fDefaultLetterCase$fArbitraryLetterCase$fDefaultPlusStyle$fArbitraryPlusStyle$fArbitraryOrientation$fArbitrary1Oriented$fArbitraryOriented$fArbitraryRotate90$fArbitrary1Rotated$fArbitraryRotated$fDefaultEmphasis$fArbitraryEmphasis$fDefaultItalicType$fArbitraryItalicType$fDefaultFontStyle$fArbitraryFontStyle$fDefaultLigate$fArbitraryLigate$fUnicodeCharacterChar$fUnicodeTextText$fUnicodeTextChar$fUnicodeText[]$fBoundedLigate$fEnumLigate $fEqLigate$fOrdLigate$fReadLigate$fShowLigate$fBoundedFontStyle$fEnumFontStyle $fEqFontStyle$fOrdFontStyle$fReadFontStyle$fShowFontStyle$fBoundedItalicType$fEnumItalicType$fEqItalicType$fOrdItalicType$fReadItalicType$fShowItalicType$fBoundedEmphasis$fEnumEmphasis$fEqEmphasis $fOrdEmphasis$fReadEmphasis$fShowEmphasis$fBoundedRotated$fEqRotated$fFoldableRotated$fFunctorRotated$fOrdRotated $fReadRotated $fShowRotated$fTraversableRotated$fBoundedRotate90$fEnumRotate90$fEqRotate90 $fOrdRotate90$fReadRotate90$fShowRotate90$fBoundedOriented$fEqOriented$fFoldableOriented$fFunctorOriented $fOrdOriented$fReadOriented$fShowOriented$fTraversableOriented$fBoundedOrientation$fEnumOrientation$fEqOrientation$fOrdOrientation$fReadOrientation$fShowOrientation$fBoundedPlusStyle$fEnumPlusStyle $fEqPlusStyle$fOrdPlusStyle$fReadPlusStyle$fShowPlusStyle$fBoundedLetterCase$fEnumLetterCase$fEqLetterCase$fOrdLetterCase$fReadLetterCase$fShowLetterCaseApplyCombine*^*^!CombiningSequence CombiningCharCombiningCharacterCombiningGraveAccentCombiningAcuteAccentCombiningCircumflexAccentCombiningTildeCombiningMacronCombiningOverlineCombiningBreveCombiningDotAboveCombiningDiaeresisCombiningHookAboveCombiningRingAboveCombiningDoubleAcuteAccentCombiningCaronCombiningVerticalLineAbove CombiningDoubleVerticalLineAboveCombiningDoubleGraveAccentCombiningCandrabinduCombiningInvertedBreveCombiningTurnedCommaAboveCombiningCommaAboveCombiningReversedCommaAboveCombiningCommaAboveRightCombiningGraveAccentBelowCombiningAcuteAccentBelowCombiningLeftTackBelowCombiningRightTackBelowCombiningLeftAngleAbove CombiningHornCombiningLeftHalfRingBelowCombiningUpTackBelowCombiningDownTackBelowCombiningPlusSignBelowCombiningMinusSignBelowCombiningPalatalizedHookBelowCombiningRetroflexHookBelowCombiningDotBelowCombiningDiaeresisBelowCombiningRingBelowCombiningCommaBelowCombiningCedillaCombiningOgonekCombiningVerticalLineBelowCombiningBridgeBelow CombiningInvertedDoubleArchBelowCombiningCaronBelowCombiningCircumflexAccentBelowCombiningBreveBelowCombiningInvertedBreveBelowCombiningTildeBelowCombiningMacronBelowCombiningLowLineCombiningDoubleLowLineCombiningTildeOverlayCombiningShortStrokeOverlayCombiningLongStrokeOverlayCombiningShortSolidusOverlayCombiningLongSolidusOverlayCombiningRightHalfRingBelowCombiningInvertedBridgeBelowCombiningSquareBelowCombiningSeagullBelowCombiningXAboveCombiningVerticalTildeCombiningDoubleOverlineCombiningGraveToneMarkCombiningAcuteToneMarkCombiningGreekPerispomeniCombiningGreekKoronisCombiningGreekDialytikaTonosCombiningGreekYpogegrammeniCombiningBridgeAboveCombiningEqualsSignBelow CombiningDoubleVerticalLineBelowCombiningLeftAngleBelowCombiningNotTildeAboveCombiningHomotheticAboveCombiningAlmostEqualToAboveCombiningLeftRightArrowBelowCombiningUpwardsArrowBelowCombiningRightArrowheadAboveCombiningLeftHalfRingAboveCombiningFermataCombiningXBelowCombiningLeftArrowheadBelowCombiningRightArrowheadBelow*CombiningRightArrowheadAndUpArrowheadBelowCombiningRightHalfRingAboveCombiningDotAboveRightCombiningAsteriskBelowCombiningDoubleRingBelowCombiningZigzagAboveCombiningDoubleBreveBelowCombiningDoubleBreveCombiningDoubleMacronCombiningDoubleMacronBelowCombiningDoubleTildeCombiningDoubleInvertedBreve#CombiningDoubleRightwardsArrowBelowCombiningLatinSmallLetterACombiningLatinSmallLetterECombiningLatinSmallLetterICombiningLatinSmallLetterOCombiningLatinSmallLetterUCombiningLatinSmallLetterCCombiningLatinSmallLetterDCombiningLatinSmallLetterHCombiningLatinSmallLetterMCombiningLatinSmallLetterRCombiningLatinSmallLetterTCombiningLatinSmallLetterVCombiningLatinSmallLetterXCombiningCyrillicTitloCombiningCyrillicPalatalizationCombiningCyrillicDasiaPneumataCombiningCyrillicPsiliPneumataCombiningCyrillicPokrytieHebrewAccentEtnahtaHebrewAccentSegolHebrewAccentShalsheletHebrewAccentZaqefQatanHebrewAccentZaqefGadolHebrewAccentTipehaHebrewAccentReviaHebrewAccentZarqaHebrewAccentPashtaHebrewAccentYetivHebrewAccentTevirHebrewAccentGereshHebrewAccentGereshMuqdamHebrewAccentGershayimHebrewAccentQarneyParaHebrewAccentTelishaGedolaHebrewAccentPazerHebrewAccentAtnahHafukhHebrewAccentMunahHebrewAccentMahapakhHebrewAccentMerkhaHebrewAccentMerkhaKefulaHebrewAccentDargaHebrewAccentQadmaHebrewAccentTelishaQetanaHebrewAccentYerahBenYomoHebrewAccentOleHebrewAccentIluyHebrewAccentDehiHebrewAccentZinorHebrewMarkMasoraCircleHebrewPointShevaHebrewPointHatafSegolHebrewPointHatafPatahHebrewPointHatafQamatsHebrewPointHiriqHebrewPointTsereHebrewPointSegolHebrewPointPatahHebrewPointQamatsHebrewPointHolamHebrewPointHolamHaserForVavHebrewPointQubutsHebrewPointDageshOrMapiqHebrewPointMetegHebrewPointRafeHebrewPointShinDotHebrewPointSinDotHebrewMarkUpperDotHebrewMarkLowerDotHebrewPointQamatsQatan$ArabicSignSallallahouAlayheWassallamArabicSignAlayheAssallamArabicSignRahmatullahAlayheArabicSignRadiAllahouAnhuArabicSignTakhallusArabicSmallHighTah)ArabicSmallHighLigatureAlefWithLamWithYehArabicSmallHighZainArabicSmallFathaArabicSmallDammaArabicSmallKasraArabicFathatanArabicDammatanArabicKasratanArabicFathaArabicDammaArabicKasraArabicShaddaArabicSukunArabicMaddahAboveArabicHamzaAboveArabicHamzaBelowArabicSubscriptAlefArabicInvertedDammaArabicMarkNoonGhunnaArabicZwarakayArabicVowelSignSmallVAbove"ArabicVowelSignInvertedSmallVAboveArabicVowelSignDotBelowArabicReversedDammaArabicFathaWithTwoDotsArabicWavyHamzaBelowArabicLetterSuperscriptAlef0ArabicSmallHighLigatureSadWithLamWithAlefMaksura0ArabicSmallHighLigatureQafWithLamWithAlefMaksuraArabicSmallHighMeemInitialFormArabicSmallHighLamAlefArabicSmallHighJeemArabicSmallHighThreeDotsArabicSmallHighSeenArabicSmallHighRoundedZero%ArabicSmallHighUprightRectangularZero ArabicSmallHighDotlessHeadOfKhahArabicSmallHighMeemIsolatedFormArabicSmallLowSeenArabicSmallHighMaddaArabicSmallHighYehArabicSmallHighNoonArabicEmptyCentreLowStopArabicEmptyCentreHighStop%ArabicRoundedHighStopWithFilledCentreArabicSmallLowMeemSyriacLetterSuperscriptAlaphSyriacPthahaAboveSyriacPthahaBelowSyriacPthahaDottedSyriacZqaphaAboveSyriacZqaphaBelowSyriacZqaphaDottedSyriacRbasaAboveSyriacRbasaBelowSyriacDottedZlamaHorizontalSyriacDottedZlamaAngularSyriacHbasaAboveSyriacHbasaBelowSyriacHbasaEsasaDottedSyriacEsasaAboveSyriacEsasaBelowSyriacRwahaSyriacFeminineDotSyriacQushshayaSyriacRukkakhaSyriacTwoVerticalDotsAboveSyriacTwoVerticalDotsBelowSyriacThreeDotsAboveSyriacThreeDotsBelowSyriacObliqueLineAboveSyriacObliqueLineBelowSyriacMusic SyriacBarrekhNkoCombiningShortHighToneNkoCombiningShortLowToneNkoCombiningShortRisingToneNkoCombiningLongDescendingToneNkoCombiningLongHighToneNkoCombiningLongLowToneNkoCombiningLongRisingToneNkoCombiningNasalizationMarkNkoCombiningDoubleDotAboveSamaritanMarkInSamaritanMarkInAlafSamaritanMarkOcclusionSamaritanMarkDageshSamaritanMarkEpentheticYutSamaritanVowelSignLongESamaritanVowelSignESamaritanVowelSignOverlongAaSamaritanVowelSignLongAaSamaritanVowelSignAaSamaritanVowelSignOverlongASamaritanVowelSignLongASamaritanVowelSignASamaritanVowelSignShortASamaritanVowelSignLongUSamaritanVowelSignUSamaritanVowelSignLongISamaritanVowelSignISamaritanVowelSignOSamaritanVowelSignSukunSamaritanMarkNequdaaMandaicAffricationMarkMandaicVocalizationMarkMandaicGeminationMarkArabicSmallHighWordArRubArabicSmallHighSadArabicSmallHighAinArabicSmallHighQafArabicSmallHighNoonWithKasraArabicSmallLowNoonWithKasraArabicSmallHighWordAthThalathaArabicSmallHighWordAsSajdaArabicSmallHighWordAnNisfArabicSmallHighWordSaktaArabicSmallHighWordQifArabicSmallHighWordWaqfaArabicSmallHighFootnoteMarkerArabicSmallHighSignSafhaArabicTurnedDammaBelowArabicCurlyFathaArabicCurlyDammaArabicCurlyKasraArabicCurlyFathatanArabicCurlyDammatanArabicCurlyKasratanArabicToneOneDotAboveArabicToneTwoDotsAboveArabicToneLoopAboveArabicToneOneDotBelowArabicToneTwoDotsBelowArabicToneLoopBelowArabicOpenFathatanArabicOpenDammatanArabicOpenKasratanArabicSmallHighWawArabicFathaWithRingArabicFathaWithDotAboveArabicKasraWithDotBelowArabicLeftArrowheadAboveArabicRightArrowheadAboveArabicLeftArrowheadBelowArabicRightArrowheadBelowArabicDoubleRightArrowheadAbove&ArabicDoubleRightArrowheadAboveWithDot ArabicRightArrowheadAboveWithDotArabicDammaWithDotArabicMarkSidewaysNoonGhunnaDevanagariSignNuktaDevanagariSignViramaDevanagariStressSignUdattaDevanagariStressSignAnudattaDevanagariGraveAccentDevanagariAcuteAccentBengaliSignNuktaBengaliVowelSignAaBengaliSignViramaBengaliAuLengthMarkGurmukhiSignNuktaGurmukhiSignViramaGujaratiSignNuktaGujaratiSignViramaOriyaSignNuktaOriyaVowelSignAaOriyaSignViramaOriyaAiLengthMarkOriyaAuLengthMarkTamilVowelSignAaTamilSignViramaTamilAuLengthMarkTeluguSignViramaTeluguLengthMarkTeluguAiLengthMarkKannadaSignNuktaKannadaVowelSignUuKannadaSignViramaKannadaLengthMarkKannadaAiLengthMarkMalayalamVowelSignAaMalayalamSignViramaMalayalamAuLengthMarkSinhalaSignAlLakunaSinhalaVowelSignAelaPillaSinhalaVowelSignGayanukittaThaiCharacterSaraUThaiCharacterSaraUuThaiCharacterPhinthuThaiCharacterMaiEkThaiCharacterMaiThoThaiCharacterMaiTriThaiCharacterMaiChattawa LaoVowelSignULaoVowelSignUuLaoToneMaiEk LaoToneMaiThoLaoToneMaiTiLaoToneMaiCatawaTibetanAstrologicalSignKhyudPa"TibetanAstrologicalSignSdongTshugsTibetanMarkNgasBzungNyiZlaTibetanMarkNgasBzungSgorRtagsTibetanMarkTsaPhruTibetanVowelSignAaTibetanVowelSignITibetanVowelSignUTibetanVowelSignETibetanVowelSignEeTibetanVowelSignOTibetanVowelSignOoTibetanVowelSignReversedITibetanSignNyiZlaNaaDaTibetanSignSnaLdanTibetanMarkHalantaTibetanSignLciRtagsTibetanSignYangRtagsTibetanSubjoinedLetterSsaTibetanSubjoinedLetterHaTibetanSymbolPadmaGdanMyanmarVowelSignIiMyanmarSignDotBelowMyanmarSignViramaMyanmarSignAsat"MyanmarSignShanCouncilEmphaticTone-EthiopicCombiningGeminationAndVowelLengthMark EthiopicCombiningVowelLengthMarkEthiopicCombiningGeminationMarkTagalogSignViramaHanunooSignPamudpodKhmerSignCoengKhmerSignAtthacanMongolianLetterAliGaliDagalgaLimbuSignMukphrengLimbuSignKemphrengLimbuSignSaIBugineseVowelSignIBugineseVowelSignUTaiThamSignSakotTaiThamSignTone1TaiThamSignTone2TaiThamSignKhuenTone3TaiThamSignKhuenTone4TaiThamSignKhuenTone5TaiThamSignRaHaamTaiThamSignMaiSamTaiThamSignKhuenLueKaran TaiThamCombiningCryptogrammicDot CombiningDoubledCircumflexAccentCombiningDiaeresisRingCombiningInfinityCombiningDownwardsArrowCombiningTripleDotCombiningXXBelowCombiningWigglyLineBelowCombiningOpenMarkBelowCombiningDoubleOpenMarkBelow'CombiningLightCentralizationStrokeBelow(CombiningStrongCentralizationStrokeBelowCombiningParenthesesAboveCombiningDoubleParenthesesAboveCombiningParenthesesBelowBalineseSignRerekanBalineseVowelSignTedungBalineseAdegAdeg#BalineseMusicalSymbolCombiningTegeh#BalineseMusicalSymbolCombiningEndep$BalineseMusicalSymbolCombiningKempul$BalineseMusicalSymbolCombiningKempli%BalineseMusicalSymbolCombiningJegogan/BalineseMusicalSymbolCombiningKempulWithJegogan/BalineseMusicalSymbolCombiningKempliWithJegogan#BalineseMusicalSymbolCombiningBende"BalineseMusicalSymbolCombiningGongSundaneseSignPamaaehSundaneseSignViramaBatakSignTompi BatakPangolatBatakPanongonanLepchaSignNuktaVedicToneKarshanaVedicToneSharaVedicTonePrenkha!VedicSignYajurvedicMidlineSvarita/VedicToneYajurvedicAggravatedIndependentSvarita%VedicToneYajurvedicIndependentSvarita,VedicToneYajurvedicKathakaIndependentSvaritaVedicToneCandraBelow5VedicToneYajurvedicKathakaIndependentSvaritaSchroederVedicToneDoubleSvaritaVedicToneTripleSvaritaVedicToneKathakaAnudattaVedicToneDotBelowVedicToneTwoDotsBelowVedicToneThreeDotsBelow+VedicToneRigvedicKashmiriIndependentSvaritaVedicSignVisargaSvaritaVedicSignVisargaUdattaVedicSignReversedVisargaUdattaVedicSignVisargaAnudatta VedicSignReversedVisargaAnudattaVedicSignVisargaUdattaWithTail VedicSignVisargaAnudattaWithTailVedicSignTiryakVedicToneCandraAboveVedicToneRingAboveVedicToneDoubleRingAboveCombiningDottedGraveAccentCombiningDottedAcuteAccentCombiningSnakeBelowCombiningSuspensionMarkCombiningMacronAcuteCombiningGraveMacronCombiningMacronGraveCombiningAcuteMacronCombiningGraveAcuteGraveCombiningAcuteGraveAcuteCombiningLatinSmallLetterRBelowCombiningBreveMacronCombiningMacronBreveCombiningDoubleCircumflexAboveCombiningOgonekAboveCombiningZigzagBelowCombiningIsBelowCombiningUrAboveCombiningUsAbove,CombiningLatinSmallLetterFlattenedOpenAAboveCombiningLatinSmallLetterAeCombiningLatinSmallLetterAoCombiningLatinSmallLetterAv!CombiningLatinSmallLetterCCedilla!CombiningLatinSmallLetterInsularDCombiningLatinSmallLetterEthCombiningLatinSmallLetterG!CombiningLatinLetterSmallCapitalGCombiningLatinSmallLetterKCombiningLatinSmallLetterL!CombiningLatinLetterSmallCapitalL!CombiningLatinLetterSmallCapitalMCombiningLatinSmallLetterN!CombiningLatinLetterSmallCapitalN!CombiningLatinLetterSmallCapitalR!CombiningLatinSmallLetterRRotundaCombiningLatinSmallLetterSCombiningLatinSmallLetterLongSCombiningLatinSmallLetterZCombiningLatinSmallLetterAlphaCombiningLatinSmallLetterBCombiningLatinSmallLetterBetaCombiningLatinSmallLetterSchwaCombiningLatinSmallLetterF/CombiningLatinSmallLetterLWithDoubleMiddleTilde7CombiningLatinSmallLetterOWithLightCentralizationStrokeCombiningLatinSmallLetterPCombiningLatinSmallLetterEsh7CombiningLatinSmallLetterUWithLightCentralizationStrokeCombiningLatinSmallLetterW'CombiningLatinSmallLetterAWithDiaeresis'CombiningLatinSmallLetterOWithDiaeresis'CombiningLatinSmallLetterUWithDiaeresisCombiningUpTackAboveCombiningDeletionMark!CombiningDoubleInvertedBreveBelowCombiningAlmostEqualToBelowCombiningLeftArrowheadAbove,CombiningRightArrowheadAndDownArrowheadBelowCombiningLeftHarpoonAboveCombiningRightHarpoonAbove CombiningLongVerticalLineOverlay!CombiningShortVerticalLineOverlay CombiningAnticlockwiseArrowAboveCombiningClockwiseArrowAboveCombiningLeftArrowAboveCombiningRightArrowAboveCombiningRingOverlayCombiningClockwiseRingOverlay!CombiningAnticlockwiseRingOverlayCombiningThreeDotsAboveCombiningFourDotsAboveCombiningLeftRightArrowAboveCombiningReverseSolidusOverlay$CombiningDoubleVerticalStrokeOverlayCombiningAnnuitySymbolCombiningTripleUnderdotCombiningWideBridgeAboveCombiningLeftwardsArrowOverlay!CombiningLongDoubleSolidusOverlay+CombiningRightwardsHarpoonWithBarbDownwards*CombiningLeftwardsHarpoonWithBarbDownwardsCombiningLeftArrowBelowCombiningRightArrowBelowCombiningAsteriskAboveCopticCombiningNiAboveCopticCombiningSpiritusAsperCopticCombiningSpiritusLenisTifinaghConsonantJoinerCombiningCyrillicLetterBeCombiningCyrillicLetterVeCombiningCyrillicLetterGheCombiningCyrillicLetterDeCombiningCyrillicLetterZheCombiningCyrillicLetterZeCombiningCyrillicLetterKaCombiningCyrillicLetterElCombiningCyrillicLetterEmCombiningCyrillicLetterEnCombiningCyrillicLetterOCombiningCyrillicLetterPeCombiningCyrillicLetterErCombiningCyrillicLetterEsCombiningCyrillicLetterTeCombiningCyrillicLetterHaCombiningCyrillicLetterTseCombiningCyrillicLetterCheCombiningCyrillicLetterShaCombiningCyrillicLetterShchaCombiningCyrillicLetterFitaCombiningCyrillicLetterEsTeCombiningCyrillicLetterACombiningCyrillicLetterIeCombiningCyrillicLetterDjerv"CombiningCyrillicLetterMonographUkCombiningCyrillicLetterYatCombiningCyrillicLetterYu CombiningCyrillicLetterIotifiedA CombiningCyrillicLetterLittleYusCombiningCyrillicLetterBigYus%CombiningCyrillicLetterIotifiedBigYusIdeographicLevelToneMarkIdeographicRisingToneMarkIdeographicDepartingToneMarkIdeographicEnteringToneMarkHangulSingleDotToneMarkHangulDoubleDotToneMark(CombiningKatakanaHiraganaVoicedSoundMark,CombiningKatakanaHiraganaSemiVoicedSoundMarkCombiningCyrillicVzmet"CombiningCyrillicLetterUkrainianIeCombiningCyrillicLetterICombiningCyrillicLetterYiCombiningCyrillicLetterUCombiningCyrillicLetterHardSignCombiningCyrillicLetterYeruCombiningCyrillicLetterSoftSignCombiningCyrillicLetterOmegaCombiningCyrillicKavykaCombiningCyrillicPayerokCombiningCyrillicLetterEf CombiningCyrillicLetterIotifiedEBamumCombiningMarkKoqndonBamumCombiningMarkTukwentisSylotiNagriSignHasantaSaurashtraSignViramaCombiningDevanagariDigitZeroCombiningDevanagariDigitOneCombiningDevanagariDigitTwoCombiningDevanagariDigitThreeCombiningDevanagariDigitFourCombiningDevanagariDigitFiveCombiningDevanagariDigitSixCombiningDevanagariDigitSevenCombiningDevanagariDigitEightCombiningDevanagariDigitNineCombiningDevanagariLetterACombiningDevanagariLetterUCombiningDevanagariLetterKaCombiningDevanagariLetterNaCombiningDevanagariLetterPaCombiningDevanagariLetterRaCombiningDevanagariLetterViCombiningDevanagariSignAvagrahaKayahLiTonePlophuKayahLiToneCalyaKayahLiToneCalyaPlophuRejangViramaJavaneseSignCecakTeluJavanesePangkonTaiVietMaiKang TaiVietVowelITaiVietVowelUe TaiVietVowelUTaiVietMaiKhitTaiVietVowelIaTaiVietVowelAmTaiVietToneMaiEkTaiVietToneMaiThoMeeteiMayekViramaMeeteiMayekApunIyekHebrewPointJudeoSpanishVarikaCombiningLigatureLeftHalfCombiningLigatureRightHalfCombiningDoubleTildeLeftHalfCombiningDoubleTildeRightHalfCombiningMacronLeftHalfCombiningMacronRightHalfCombiningConjoiningMacronCombiningLigatureLeftHalfBelowCombiningLigatureRightHalfBelowCombiningTildeLeftHalfBelowCombiningTildeRightHalfBelowCombiningMacronLeftHalfBelowCombiningMacronRightHalfBelowCombiningConjoiningMacronBelowCombiningCyrillicTitloLeftHalfCombiningCyrillicTitloRightHalf&PhaistosDiscSignCombiningObliqueStrokeCopticEpactThousandsMarkCombiningOldPermicLetterAnCombiningOldPermicLetterDoiCombiningOldPermicLetterZataCombiningOldPermicLetterNenoeCombiningOldPermicLetterSiiKharoshthiSignDoubleRingBelowKharoshthiSignVisargaKharoshthiSignBarAboveKharoshthiSignCaudaKharoshthiSignDotBelowKharoshthiViramaManichaeanAbbreviationMarkAboveManichaeanAbbreviationMarkBelowBrahmiViramaBrahmiNumberJoinerKaithiSignViramaKaithiSignNuktaChakmaSignCandrabinduChakmaSignAnusvaraChakmaSignVisargaChakmaVowelSignAChakmaVirama ChakmaMaayyaaMahajaniSignNuktaSharadaSignViramaSharadaSignNuktaKhojkiSignViramaKhojkiSignNuktaKhudawadiSignNuktaKhudawadiSignViramaGranthaSignNuktaGranthaVowelSignAaGranthaSignViramaGranthaAuLengthMarkCombiningGranthaDigitZeroCombiningGranthaDigitOneCombiningGranthaDigitTwoCombiningGranthaDigitThreeCombiningGranthaDigitFourCombiningGranthaDigitFiveCombiningGranthaDigitSixCombiningGranthaLetterACombiningGranthaLetterKaCombiningGranthaLetterNaCombiningGranthaLetterViCombiningGranthaLetterPaNewaSignVirama NewaSignNuktaTirhutaVowelSignAaTirhutaVowelSignShortETirhutaVowelSignShortOTirhutaSignViramaTirhutaSignNuktaSiddhamVowelSignAaSiddhamSignViramaSiddhamSignNuktaModiSignViramaTakriSignViramaTakriSignNuktaAhomSignKillerBhaiksukiSignViramaBassaVahCombiningHighToneBassaVahCombiningLowToneBassaVahCombiningMidToneBassaVahCombiningLowMidToneBassaVahCombiningHighLowTonePahawhHmongMarkCimTubPahawhHmongMarkCimSoPahawhHmongMarkCimKesPahawhHmongMarkCimKhavPahawhHmongMarkCimSuamPahawhHmongMarkCimHomPahawhHmongMarkCimTaumDuployanDoubleMarkMusicalSymbolCombiningStem&MusicalSymbolCombiningSprechgesangStemMusicalSymbolCombiningTremolo1MusicalSymbolCombiningTremolo2MusicalSymbolCombiningTremolo3%MusicalSymbolCombiningAugmentationDotMusicalSymbolCombiningFlag1MusicalSymbolCombiningFlag2MusicalSymbolCombiningFlag3MusicalSymbolCombiningFlag4MusicalSymbolCombiningFlag5MusicalSymbolCombiningAccentMusicalSymbolCombiningStaccatoMusicalSymbolCombiningTenuto#MusicalSymbolCombiningStaccatissimoMusicalSymbolCombiningMarcato%MusicalSymbolCombiningMarcatoStaccato$MusicalSymbolCombiningAccentStaccatoMusicalSymbolCombiningLoureMusicalSymbolCombiningDoitMusicalSymbolCombiningRipMusicalSymbolCombiningFlipMusicalSymbolCombiningSmearMusicalSymbolCombiningBend"MusicalSymbolCombiningDoubleTongue"MusicalSymbolCombiningTripleTongueMusicalSymbolCombiningDownBowMusicalSymbolCombiningUpBowMusicalSymbolCombiningHarmonic#MusicalSymbolCombiningSnapPizzicatoCombiningGreekMusicalTrisemeCombiningGreekMusicalTetrasemeCombiningGreekMusicalPentasemeCombiningGlagoliticLetterAzuCombiningGlagoliticLetterBukyCombiningGlagoliticLetterVede CombiningGlagoliticLetterGlagoliCombiningGlagoliticLetterDobroCombiningGlagoliticLetterYestu CombiningGlagoliticLetterZhiveteCombiningGlagoliticLetterZemljaCombiningGlagoliticLetterIzhe$CombiningGlagoliticLetterInitialIzheCombiningGlagoliticLetterICombiningGlagoliticLetterDjerviCombiningGlagoliticLetterKako CombiningGlagoliticLetterLjudije CombiningGlagoliticLetterMysliteCombiningGlagoliticLetterNashiCombiningGlagoliticLetterOnuCombiningGlagoliticLetterPokojiCombiningGlagoliticLetterRitsiCombiningGlagoliticLetterSlovoCombiningGlagoliticLetterTvridoCombiningGlagoliticLetterUkuCombiningGlagoliticLetterFrituCombiningGlagoliticLetterHeruCombiningGlagoliticLetterShtaCombiningGlagoliticLetterTsiCombiningGlagoliticLetterChriviCombiningGlagoliticLetterShaCombiningGlagoliticLetterYeruCombiningGlagoliticLetterYeriCombiningGlagoliticLetterYatiCombiningGlagoliticLetterYu!CombiningGlagoliticLetterSmallYusCombiningGlagoliticLetterYo(CombiningGlagoliticLetterIotatedSmallYusCombiningGlagoliticLetterBigYus&CombiningGlagoliticLetterIotatedBigYusCombiningGlagoliticLetterFita MendeKikakuiCombiningNumberTeensMendeKikakuiCombiningNumberTens#MendeKikakuiCombiningNumberHundreds$MendeKikakuiCombiningNumberThousands'MendeKikakuiCombiningNumberTenThousands+MendeKikakuiCombiningNumberHundredThousands#MendeKikakuiCombiningNumberMillionsAdlamAlifLengthenerAdlamVowelLengthenerAdlamGeminationMark AdlamHamzaAdlamConsonantModifierAdlamGeminateConsonantModifier AdlamNuktaMendeKikakuiNumberMillions"MendeKikakuiNumberHundredThousandsMendeKikakuiNumberTenThousandsMendeKikakuiNumberThousandsMendeKikakuiNumberHundredsMendeKikakuiNumberTensMendeKikakuiNumberTeensGlagoliticLetterFitaGlagoliticLetterIotatedBigYusGlagoliticLetterBigYusGlagoliticLetterIotatedSmallYusGlagoliticLetterYoGlagoliticLetterSmallYusGlagoliticLetterYuGlagoliticLetterYatiGlagoliticLetterYeriGlagoliticLetterYeruGlagoliticLetterShaGlagoliticLetterChriviGlagoliticLetterTsiGlagoliticLetterShtaGlagoliticLetterHeruGlagoliticLetterFrituGlagoliticLetterUkuGlagoliticLetterTvridoGlagoliticLetterSlovoGlagoliticLetterRitsiGlagoliticLetterPokojiGlagoliticLetterOnuGlagoliticLetterNashiGlagoliticLetterMysliteGlagoliticLetterLjudijeGlagoliticLetterKakoGlagoliticLetterDjerviGlagoliticLetterIGlagoliticLetterInitialIzheGlagoliticLetterIzheGlagoliticLetterZemljaGlagoliticLetterZhiveteGlagoliticLetterYestuGlagoliticLetterDobroGlagoliticLetterGlagoliGlagoliticLetterVedeGlagoliticLetterBukyGlagoliticLetterAzuGreekMusicalPentasemeGreekMusicalTetrasemeGreekMusicalTrisemeMusicalSymbolSnapPizzicatoMusicalSymbolHarmonicMusicalSymbolUpBowMusicalSymbolDownBowMusicalSymbolTripleTongueMusicalSymbolDoubleTongueMusicalSymbolBendMusicalSymbolSmearMusicalSymbolFlipMusicalSymbolRipMusicalSymbolDoitMusicalSymbolLoureMusicalSymbolAccentStaccatoMusicalSymbolMarcatoStaccatoMusicalSymbolMarcatoMusicalSymbolStaccatissimoMusicalSymbolTenutoMusicalSymbolStaccatoMusicalSymbolAccentMusicalSymbolFlag5MusicalSymbolFlag4MusicalSymbolFlag3MusicalSymbolFlag2MusicalSymbolFlag1MusicalSymbolAugmentationDotMusicalSymbolTremolo3MusicalSymbolTremolo2MusicalSymbolTremolo1MusicalSymbolSprechgesangStemMusicalSymbolStemBassaVahHighLowToneBassaVahLowMidToneBassaVahMidToneBassaVahLowToneBassaVahHighToneGranthaLetterPaGranthaLetterViGranthaLetterNaGranthaLetterKaGranthaLetterAGranthaDigitSixGranthaDigitFiveGranthaDigitFourGranthaDigitThreeGranthaDigitTwoGranthaDigitOneGranthaDigitZeroOldPermicLetterSiiOldPermicLetterNenoeOldPermicLetterZataOldPermicLetterDoiOldPermicLetterAnPhaistosDiscSignObliqueStrokeCyrillicTitloRightHalfCyrillicTitloLeftHalfConjoiningMacronBelowMacronRightHalfBelowMacronLeftHalfBelowTildeRightHalfBelowTildeLeftHalfBelowLigatureRightHalfBelowLigatureLeftHalfBelowConjoiningMacronMacronRightHalfMacronLeftHalfDoubleTildeRightHalfDoubleTildeLeftHalfLigatureRightHalfLigatureLeftHalfDevanagariSignAvagrahaDevanagariLetterViDevanagariLetterRaDevanagariLetterPaDevanagariLetterNaDevanagariLetterKaDevanagariLetterUDevanagariLetterADevanagariDigitNineDevanagariDigitEightDevanagariDigitSevenDevanagariDigitSixDevanagariDigitFiveDevanagariDigitFourDevanagariDigitThreeDevanagariDigitTwoDevanagariDigitOneDevanagariDigitZeroBamumMarkTukwentisBamumMarkKoqndonCyrillicLetterIotifiedECyrillicLetterEfCyrillicPayerokCyrillicKavykaCyrillicLetterOmegaCyrillicLetterSoftSignCyrillicLetterYeruCyrillicLetterHardSignCyrillicLetterUCyrillicLetterYiCyrillicLetterICyrillicLetterUkrainianIe CyrillicVzmet#KatakanaHiraganaSemiVoicedSoundMarkKatakanaHiraganaVoicedSoundMarkCyrillicLetterIotifiedBigYusCyrillicLetterBigYusCyrillicLetterLittleYusCyrillicLetterIotifiedACyrillicLetterYuCyrillicLetterYatCyrillicLetterMonographUkCyrillicLetterDjervCyrillicLetterIeCyrillicLetterACyrillicLetterEsTeCyrillicLetterFitaCyrillicLetterShchaCyrillicLetterShaCyrillicLetterCheCyrillicLetterTseCyrillicLetterHaCyrillicLetterTeCyrillicLetterEsCyrillicLetterErCyrillicLetterPeCyrillicLetterOCyrillicLetterEnCyrillicLetterEmCyrillicLetterElCyrillicLetterKaCyrillicLetterZeCyrillicLetterZheCyrillicLetterDeCyrillicLetterGheCyrillicLetterVeCyrillicLetterBeCopticSpiritusLenisCopticSpiritusAsper CopticNiAbove AsteriskAboveRightArrowBelowLeftArrowBelow!LeftwardsHarpoonWithBarbDownwards"RightwardsHarpoonWithBarbDownwardsLongDoubleSolidusOverlayLeftwardsArrowOverlayWideBridgeAboveTripleUnderdot AnnuitySymbolDoubleVerticalStrokeOverlayReverseSolidusOverlayLeftRightArrowAbove FourDotsAboveThreeDotsAboveAnticlockwiseRingOverlayClockwiseRingOverlayRingOverlayRightArrowAboveLeftArrowAboveClockwiseArrowAboveAnticlockwiseArrowAboveShortVerticalLineOverlayLongVerticalLineOverlayRightHarpoonAboveLeftHarpoonAbove#RightArrowheadAndDownArrowheadBelowLeftArrowheadAboveAlmostEqualToBelowDoubleInvertedBreveBelowDeletionMarkUpTackAboveLatinSmallLetterUWithDiaeresisLatinSmallLetterOWithDiaeresisLatinSmallLetterAWithDiaeresisLatinSmallLetterW.LatinSmallLetterUWithLightCentralizationStrokeLatinSmallLetterEshLatinSmallLetterP.LatinSmallLetterOWithLightCentralizationStroke&LatinSmallLetterLWithDoubleMiddleTildeLatinSmallLetterFLatinSmallLetterSchwaLatinSmallLetterBetaLatinSmallLetterBLatinSmallLetterAlphaLatinSmallLetterZLatinSmallLetterLongSLatinSmallLetterSLatinSmallLetterRRotundaLatinLetterSmallCapitalRLatinLetterSmallCapitalNLatinSmallLetterNLatinLetterSmallCapitalMLatinLetterSmallCapitalLLatinSmallLetterLLatinSmallLetterKLatinLetterSmallCapitalGLatinSmallLetterGLatinSmallLetterEthLatinSmallLetterInsularDLatinSmallLetterCCedillaLatinSmallLetterAvLatinSmallLetterAoLatinSmallLetterAe#LatinSmallLetterFlattenedOpenAAboveUsAboveUrAboveIsBelowZigzagBelowOgonekAboveDoubleCircumflexAboveMacronBreveBreveMacronLatinSmallLetterRBelowAcuteGraveAcuteGraveAcuteGraveAcuteMacronMacronGraveGraveMacronMacronAcuteSuspensionMark SnakeBelowDottedAcuteAccentDottedGraveAccentBalineseMusicalSymbolGongBalineseMusicalSymbolBende&BalineseMusicalSymbolKempliWithJegogan&BalineseMusicalSymbolKempulWithJegoganBalineseMusicalSymbolJegoganBalineseMusicalSymbolKempliBalineseMusicalSymbolKempulBalineseMusicalSymbolEndepBalineseMusicalSymbolTegehParenthesesBelowDoubleParenthesesAboveParenthesesAboveStrongCentralizationStrokeBelowLightCentralizationStrokeBelowDoubleOpenMarkBelow OpenMarkBelowWigglyLineBelowXXBelow TripleDotDownwardsArrowInfinity DiaeresisRingDoubledCircumflexAccentTaiThamCryptogrammicDotEthiopicGeminationMarkEthiopicVowelLengthMark$EthiopicGeminationAndVowelLengthMarkNkoDoubleDotAboveNkoNasalizationMarkNkoLongRisingToneNkoLongLowToneNkoLongHighToneNkoLongDescendingToneNkoShortRisingToneNkoShortLowToneNkoShortHighToneCyrillicPokrytieCyrillicPsiliPneumataCyrillicDasiaPneumataCyrillicPalatalization CyrillicTitloLatinSmallLetterXLatinSmallLetterVLatinSmallLetterTLatinSmallLetterRLatinSmallLetterMLatinSmallLetterHLatinSmallLetterDLatinSmallLetterCLatinSmallLetterULatinSmallLetterOLatinSmallLetterILatinSmallLetterELatinSmallLetterADoubleRightwardsArrowBelowDoubleInvertedBreveDoubleTildeDoubleMacronBelowDoubleMacronDoubleBreveDoubleBreveBelowZigzagAboveDoubleRingBelow AsteriskBelow DotAboveRightRightHalfRingAbove!RightArrowheadAndUpArrowheadBelowRightArrowheadBelowLeftArrowheadBelowXBelowFermataLeftHalfRingAboveRightArrowheadAboveUpwardsArrowBelowLeftRightArrowBelowAlmostEqualToAboveHomotheticAbove NotTildeAboveLeftAngleBelowDoubleVerticalLineBelowEqualsSignBelowBridgeAboveGreekYpogegrammeniGreekDialytikaTonosGreekKoronisGreekPerispomeni AcuteToneMark GraveToneMarkDoubleOverline VerticalTildeXAboveSeagullBelowSquareBelowInvertedBridgeBelowRightHalfRingBelowLongSolidusOverlayShortSolidusOverlayLongStrokeOverlayShortStrokeOverlayTildeOverlay DoubleLowLineLowLineMacronBelow TildeBelowInvertedBreveBelow BreveBelowCircumflexAccentBelow CaronBelowInvertedDoubleArchBelowBridgeBelowVerticalLineBelowOgonekCedilla CommaBelow RingBelowDiaeresisBelowDotBelowRetroflexHookBelowPalatalizedHookBelowMinusSignBelow PlusSignBelow DownTackBelowUpTackBelowLeftHalfRingBelowHornLeftAngleAboveRightTackBelow LeftTackBelowAcuteAccentBelowGraveAccentBelowCommaAboveRightReversedCommaAbove CommaAboveTurnedCommaAbove InvertedBreveCandrabinduDoubleGraveAccentDoubleVerticalLineAboveVerticalLineAboveCaronDoubleAcuteAccent RingAbove HookAbove DiaeresisDotAboveBreveOverlineMacronTildeCircumflexAccentAcuteAccentGraveAccentcombiningToUnicodeisCombiningCharactercombiningCharacter'combiningCharacterdecomposeCombiningSequencestripCombiningSequencestripCombiningsdecomposeCombiningcomposeCombiningSequencecomposeCombiningSequence'composeCombiningcomposeCombining'$fUnicodeTextCombiningCharacter$$fUnicodeCharacterCombiningCharacter$fArbitraryCombiningCharacter$fIsString[]$fIsStringCombiningCharacter$fArbitraryCombiningSequence$fIsStringCombiningSequence'$fApplyCombineCharCombiningSequenceText$fApplyCombineChar[]Text($fApplyCombineCharCombiningCharacterText$$fApplyCombineCombiningCharacter[][]б$fApplyCombineCombiningCharacterCombiningSequenceCombiningSequenceц$fApplyCombineCombiningCharacterCombiningCharacterCombiningSequence$fEqCombiningSequence$fOrdCombiningSequence$fReadCombiningSequence$fShowCombiningSequence$fBoundedCombiningCharacter$fEnumCombiningCharacter$fEqCombiningCharacter$fOrdCombiningCharacter$fReadCombiningCharacter$fShowCombiningCharacter ChessPieceChess90 Chess45KnightChessHybridChessHybridTypeKnightQueen KnightRookKnightBishopRotate45R45R135R225R315ChessPieceTypeKingQueenRookBishopKnightPawn Equihopper ChessColorWhiteBlackNeutralChessColorBinaryBWhiteBBlackPrincessCardinalEmpressMarshall Chancellor SuperqueenOmnipotentQueenTerrorAmazon NightriderGrasshopper chessPiece$fArbitraryChessColorBinary$fArbitraryChessColor$fArbitraryChessPieceType$fArbitraryRotate45$fArbitraryChessHybridType$fArbitraryChessPiece$fEqChessPiece$fOrdChessPiece$fReadChessPiece$fShowChessPiece$fBoundedChessHybridType$fEnumChessHybridType$fEqChessHybridType$fOrdChessHybridType$fReadChessHybridType$fShowChessHybridType$fBoundedRotate45$fEnumRotate45$fEqRotate45 $fOrdRotate45$fReadRotate45$fShowRotate45$fBoundedChessPieceType$fEnumChessPieceType$fEqChessPieceType$fOrdChessPieceType$fReadChessPieceType$fShowChessPieceType$fBoundedChessColor$fEnumChessColor$fEqChessColor$fOrdChessColor$fReadChessColor$fShowChessColor$fBoundedChessColorBinary$fEnumChessColorBinary$fEqChessColorBinary$fOrdChessColorBinary$fReadChessColorBinary$fShowChessColorBinaryCardBackJokerTrumpFoolTrump1Trump2Trump3Trump4Trump5Trump6Trump7Trump8Trump9Trump10Trump11Trump12Trump13Trump14Trump15Trump16Trump17Trump18Trump19Trump20Trump21 JokerColorRedCardRankAceR2R3R4R5R6R7R8R9R10JackCardSuitSpadesHeartsDiamondsClubs CollectiveGameWinterAutumnSummerSpring VisualArtsOpenAirShoppingDanceFireWaterAirEarthNightEvening AfternoonMorningOldAgeMaturityYouth Childhood IndividualReKцІnigRoiReginaKцІniginDame CavaliereCavallRitterOber ChevalierFantePageUnterBubeValetWands PentaclesCupsSwordsbackcard'jokertrumpcard$fUnicodeTextCardSuit$fUnicodeCharacterCardSuit$fArbitraryCardSuit$fArbitraryCardRank$fArbitraryJokerColor$fArbitraryTrump $fBoundedCard$fArbitraryCard$fEqCard $fOrdCard $fReadCard $fShowCard$fBoundedTrump$fEnumTrump $fEqTrump $fOrdTrump$fReadTrump$fShowTrump$fBoundedJokerColor$fEnumJokerColor$fEqJokerColor$fOrdJokerColor$fReadJokerColor$fShowJokerColor$fBoundedCardRank$fEnumCardRank$fEqCardRank $fOrdCardRank$fReadCardRank$fShowCardRank$fBoundedCardSuit$fEnumCardSuit$fEqCardSuit $fOrdCardSuit$fReadCardSuit$fShowCardSuitBlockupperlowerRowleftright fromBlock fromBlock'filled$fArbitrary1Row$fArbitraryRow$fApplicativeRow$fUnicodeTextBlock$fUnicodeCharacterBlock$fArbitrary1Block$fArbitraryBlock$fApplicativeBlock$fBoundedBlock $fEqBlock$fFoldableBlock$fFunctorBlock $fOrdBlock$fReadBlock$fShowBlock$fTraversableBlock$fBoundedRow$fEqRow $fFoldableRow$fFunctorRow$fOrdRow $fReadRow $fShowRow$fTraversableRowBraillerow1row2row3row4Braille6topmiddlebottom toBraille' toBraillefromBraille' fromBraille6'fromBraillefromBraille6braille6braille$fUnicodeTextBraille6$fUnicodeCharacterBraille6$fArbitrary1Braille6$fArbitraryBraille6$fUnicodeTextBraille$fUnicodeCharacterBraille$fArbitrary1Braille$fArbitraryBraille$fBoundedBraille$fEqBraille$fFoldableBraille$fFunctorBraille$fOrdBraille $fReadBraille $fShowBraille$fTraversableBraille$fBoundedBraille6$fEqBraille6$fFoldableBraille6$fFunctorBraille6 $fOrdBraille6$fReadBraille6$fShowBraille6$fTraversableBraille6 BallotBoxEmptyCheckCross toCheckBox toCrossBox$fUnicodeTextBallotBox$fUnicodeCharacterBallotBox$fArbitraryBallotBox$fBoundedBallotBox$fEnumBallotBox $fEqBallotBox$fOrdBallotBox$fReadBallotBox$fShowBallotBoxDieValueIIIIIIIVVVI toDieValuedie$fUnicodeTextDieValue$fUnicodeCharacterDieValue$fArbitraryDieValue$fBoundedDieValue$fEnumDieValue$fEqDieValue $fOrdDieValue$fReadDieValue$fShowDieValue ComplexDominoSimpleDominoOrientedDominoDominoleftToprightBottom:|fromDomino' fromDominodominoHdominoH'dominoVdominoV'dominodomino'$fUnicodeTextOriented$fUnicodeTextOriented0$fUnicodeCharacterOriented$fUnicodeCharacterOriented0$fBoundedDomino$fArbitrary1Domino$fArbitraryDomino$fApplicativeDomino $fEqDomino$fFoldableDomino$fFunctorDomino$fOrdDomino$fReadDomino$fShowDomino$fTraversableDominoAA032AA031AA030AA029AA028AA027AA026AA025AA024AA023AA022AA021AA020AA019AA018AA017AA016AA015AA014AA013AA012AA011AA010AA009AA008AA007BAA007AAA007AA006AA005AA004AA003AA002AA001Z016HZ016GZ016FZ016EZ016DZ016CZ016BZ016AZ016Z015IZ015HZ015GZ015FZ015EZ015DZ015CZ015BZ015AZ015Z014Z013Z012Z011Z010Z009Z008Z007Z006Z005AZ005Z004AZ004Z003BZ003AZ003Z002DZ002CZ002BZ002AZ002Z001Y008Y007Y006Y005Y004Y003Y002Y001AY001X008AX008X007X006AX006X005X004BX004AX004X003X002X001W025W024AW024W023W022W021W020W019W018AW018W017AW017W016W015W014AW014W013W012W011W010AW010W009AW009W008W007W006W005W004W003AW003W002W001V040AV040V039V038V037AV037V036V035V034V033AV033V032V031AV031V030AV030V029AV029V028AV028V027V026V025V024V023AV023V022V021V020LV020KV020JV020IV020HV020GV020FV020EV020DV020CV020BV020AV020V019V018V017V016V015V014V013V012BV012AV012V011CV011BV011AV011V010V009V008V007BV007AV007V006V005V004V003V002AV002V001IV001HV001GV001FV001EV001DV001CV001BV001AV001U042U041U040U039U038U037U036U035U034U033U032AU032U031U030U029AU029U028U027U026U025U024U023AU023U022U021U020U019U018U017U016U015U014U013U012U011U010U009U008U007U006BU006AU006U005U004U003U002U001T036T035T034T033AT033T032AT032T031T030T029T028T027T026T025T024T023T022T021T020T019T018T017T016AT016T015T014T013T012T011AT011T010T009AT009T008AT008T007AT007T006T005T004T003AT003T002T001S046S045S044S043S042S041S040S039S038S037S036S035AS035S034S033S032S031S030S029S028S027S026BS026AS026S025S024S023S022S021S020S019S018S017AS017S016S015S014BS014AS014S013S012S011S010S009S008S007S006AS006S005S004S003S002AS002S001R029R028R027R026R025R024R023R022R021R020R019R018R017R016AR016R015R014R013R012R011R010AR010R009R008R007R006R005R004R003BR003AR003R002AR002R001Q007Q006Q005Q004Q003Q002Q001P011P010P009P008P007P006P005P004P003AP003P002P001AP001O051O050BO050AO050O049O048O047O046O045O044O043O042O041O040O039O038O037O036DO036CO036BO036AO036O035O034O033AO033O032O031O030AO030O029AO029O028O027O026O025AO025O024AO024O023O022O021O020AO020O019AO019O018O017O016O015O014O013O012O011O010CO010BO010AO010O009O008O007O006FO006EO006DO006CO006BO006AO006O005AO005O004O003O002O001AO001NU022ANU022NU021NU020NU019NU018ANU018NU017NU016NU015NU014NU013NU012NU011ANU011NU010ANU010NU009NU008NU007NU006NU005NU004NU003NU002NU001NL020NL019NL018NL017ANL017NL016NL015NL014NL013NL012NL011NL010NL009NL008NL007NL006NL005ANL005NL004NL003NL002NL001N042N041N040N039N038N037AN037N036N035AN035N034AN034N033AN033N032N031N030N029N028N027N026N025AN025N024N023N022N021N020N019N018BN018AN018N017N016N015N014N013N012N011N010N009N008N007N006N005N004N003N002N001M044M043M042M041M040AM040M039M038M037M036M035M034M033BM033AM033M032M031AM031M030M029M028AM028M027M026M025M024AM024M023M022AM022M021M020M019M018M017AM017M016AM016M015AM015M014M013M012HM012GM012FM012EM012DM012CM012BM012AM012M011M010AM010M009M008M007M006M005M004M003AM003M002M001BM001AM001L008L007L006AL006L005L004L003L002AL002L001K008K007K006K005K004K003K002K001I015I014I013I012I011AI011I010AI010I009AI009I008I007I006I005AI005I004I003I002I001H008H007H006AH006H005H004H003H002H001G054G053G052G051G050G049G048G047G046G045AG045G044G043AG043G042G041G040G039G038G037AG037G036AG036G035G034G033G032G031G030G029G028G027G026AG026G025G024G023G022G021G020AG020G019G018G017G016G015G014G013G012G011AG011G010G009G008G007BG007AG007G006AG006G005G004G003G002G001F053F052F051CF051BF051AF051F050F049F048F047AF047F046AF046F045AF045F044F043F042F041F040F039F038AF038F037AF037F036F035F034F033F032F031AF031F030F029F028F027F026F025F024F023F022F021AF021F020F019F018F017F016F015F014F013AF013F012F011F010F009F008F007F006F005F004F003F002F001AF001E038E037E036E034AE034E033E032E031E030E029E028AE028E027E026E025E024E023E022E021E020AE020E019E018E017AE017E016AE016E015E014E013E012E011E010E009AE009E008AE008E007E006E005E004E003E002E001D067HD067GD067FD067ED067DD067CD067BD067AD067D066D065D064D063D062D061D060D059D058D057D056D055D054AD054D053D052AD052D051D050ID050HD050GD050FD050ED050DD050CD050BD050AD050D049D048AD048D047D046AD046D045D044D043D042D041D040D039D038D037D036D035D034AD034D033D032D031AD031D030D029D028D027AD027D026D025D024D023D022D021D020D019D018D017D016D015D014D013D012D011D010D009D008AD008D007D006D005D004D003D002D001C024C023C022C021C020C019C018C017C016C015C014C013C012C011C010AC010C009C008C007C006C005C004C003C002CC002BC002AC002C001B009B008B007B006B005AB005B004B003B002B001A070A069A068A067A066A065A064A063A062A061A060A059A058A057A056A055A054A053A052A051A050A049A048A047A046A045AA045A044A043AA043A042AA042A041A040AA040A039A038A037A036A035A034A033A032AA032A031A030A029A028A027A026A025A024A023A022A021A020A019A018A017AA017A016A015A014AA014A013A012A011A010A009A008A007A006BA006AA006A005AA005A004A003A002A001 circledNumbercircledNumber'circledAlpha circledAlpha'parenthesizedNumberparenthesizedNumber'numberWithPeriodnumberWithPeriod'doubleCircledNumberdoubleCircledNumber'numberWithCommanumberWithComma'parenthesizedAlphaparenthesizedAlpha'squaredUppercasesquaredUppercase'whiteOnBlackCircledUppercasewhiteOnBlackCircledUppercase'whiteOnBlackSquaredUppercasewhiteOnBlackSquaredUppercase'numberWhiteOnBlackCirclenumberWhiteOnBlackCircle'regionalIndicatorUppercaseregionalIndicatorUppercase' MoonPhaseNewMoonWaxingCrescentFirstQuarter WaxingGibbousFullMoon WaningGibbousThirdQuarterWaningCrescentZodiacAriesTaurusGeminiCancerLeoVirgoLibraScorpioSagittarius CapricornAquariusPiscesSkinColorModifierLightMediumLightMedium MediumDarkDarkGenderFemaleMale BloodTypeOBAABClockhours minutes30SubFlagFlagFishWaterBearerSeaGoat GoatHornedMountainGoatCapricornusArcherCentaurScorpionScorpiusScalesMaidenLionCrabTwinsBullRam FitzPatrickVIFitzPatrickV FitzPatrickIVFitzPatrickIII FitzPatrickIIFitzPatrickIWLSSCTENGZWZMZAYTYEXKWSWFVUVNVGVEVCVAUZUYUSUNUMUGUATZTWTVTTTRTOTNTMTLTKTJTHTGTFTDTCTASZSYSXSVSTSSSRSOSNSMSLSKSJSISHSGSESDSCSBSARWRURSROREQAPYPWPTPSPRPNPMPLPKPHPGPFPEPAOMNZNUNRNPNONLNINGNFNENCNAMZMYMXMWMVMUMTMSMRMQMPMOMNMMMLMKMHMGMFMEMDMCMALYLVLULTLSLRLKLILCLBLAKZKYKWKRKPKNKMKIKHKGKEJPJOJMJEITISIRIQIOINIMILIEIDICHUHTHRHNHMHKGYGWGUGTGSGRGQGPGNGMGLGIGHGGGFGEGDGBGAFRFOFMFKFJFIEUETESEREHEGEEECEADZDODMDKDJDGDECZCYCXCWCVCUCRCPCOCNCMCLCKCICHCGCFCDCCCABZBYBWBVBTBSBRBQBOBNBMBLBJBIBHBGBFBEBDBBBAAZAXAWAUATASARAQAOAMALAIAGAFAEADACEmojiSuffixflagflag' flagCharsclosestClockclockfromFitzPatrickiso3166Alpha2ToFlag'iso3166Alpha2ToFlagvalidFlagEmoji$fUnicodeTextFlag $fEnumFlag$fArbitraryFlag $fBoundedFlag$fUnicodeTextSubFlag $fEnumSubFlag$fArbitrarySubFlag$fBoundedSubFlag$fUnicodeTextClock$fUnicodeCharacterClock$fArbitraryClock$fEnumClock$fBoundedClock$fUnicodeTextBloodType$fArbitraryBloodType$fBitsBloodType$fUnicodeTextGender$fArbitraryGender$fUnicodeTextSkinColorModifier#$fUnicodeCharacterSkinColorModifier$fArbitrarySkinColorModifier$fUnicodeTextZodiac$fUnicodeCharacterZodiac$fArbitraryZodiac$fUnicodeTextMoonPhase$fUnicodeCharacterMoonPhase$fArbitraryMoonPhase$fBoundedMoonPhase$fEnumMoonPhase $fEqMoonPhase$fOrdMoonPhase$fReadMoonPhase$fShowMoonPhase$fBoundedZodiac$fEnumZodiac $fEqZodiac$fOrdZodiac$fReadZodiac$fShowZodiac$fBoundedSkinColorModifier$fEnumSkinColorModifier$fEqSkinColorModifier$fOrdSkinColorModifier$fReadSkinColorModifier$fShowSkinColorModifier$fBoundedGender$fEnumGender $fEqGender$fOrdGender$fReadGender$fShowGender$fBoundedBloodType$fEnumBloodType $fEqBloodType$fOrdBloodType$fReadBloodType$fShowBloodType $fEqClock $fOrdClock$fShowClock$fEqSubFlag$fOrdSubFlag $fShowSubFlag$fEqFlag $fOrdFlag $fShowFlagWeightedSimpleWeightHeavyPartsupdownFrameweightedToSimplesimpleToWeighted simpleToLight simpleToHeavysimplesimple' simpleWithArcweighted fromWeighted' fromLight fromLight' fromHeavy fromHeavy'fromSimple' fromSimplefromWeighted$fApplicativeHorizontal$fArbitrary1Horizontal$fArbitraryHorizontal$fMonoidHorizontal$fSemigroupHorizontal$fApplicativeVertical$fArbitrary1Vertical$fArbitraryVertical$fMonoidVertical$fSemigroupVertical$fUnicodeTextParts$fUnicodeCharacterParts$fApplicativeParts$fArbitrary1Parts$fArbitraryParts $fMonoidParts$fSemigroupParts$fUnicodeTextParts0$fUnicodeCharacterParts0$fArbitraryWeight$fBoundedWeight$fEnumWeight $fEqWeight$fOrdWeight$fReadWeight$fShowWeight$fBoundedParts $fEqParts$fFoldableParts$fFunctorParts $fOrdParts$fReadParts$fShowParts$fTraversableParts$fBoundedVertical$fEqVertical$fFoldableVertical$fFunctorVertical $fOrdVertical$fReadVertical$fShowVertical$fTraversableVertical$fBoundedHorizontal$fEqHorizontal$fFoldableHorizontal$fFunctorHorizontal$fOrdHorizontal$fReadHorizontal$fShowHorizontal$fTraversableHorizontalfrakturRegular'frakturRegularfrakturBold'frakturBoldfraktur'fraktur doubleStruck'doubleStruckintToDigitDoubleStruck'intToDigitDoubleStruckdigitDoubleStruck'digitDoubleStruck monospace' monospaceintToDigitMonospace'intToDigitMonospacedigitMonospace'digitMonospacedigitSansSerifRegular'digitSansSerifRegulardigitSansSerifBold'digitSansSerifBolddigitSansSerif'digitSansSerifintToDigitSansSerifRegular'intToDigitSansSerifRegularintToDigitSansSerifBold'intToDigitSansSerifBoldintToDigitSansSerif'intToDigitSansSerifgreekSansSerifgreekSansSerif'greekSansSerifNoBoldNoItalic'greekSansSerifNoBoldNoItalicgreekSansSerifNoBoldItalic'greekSansSerifNoBoldItalicgreekSansSerifBoldNoItalic'greekSansSerifBoldNoItalicgreekSansSerifBoldItalic'greekSansSerifBoldItalicgreekSansSerifBold'greekSansSerifBoldgreekSansSerifNoBold'greekSansSerifNoBoldgreekSansSerifItalic'greekSansSerifItalicgreekSansSerifNoItalic'greekSansSerifNoItaliclatinSansSeriflatinSansSerif'latinSansSerifNoBoldNoItalic'latinSansSerifNoBoldNoItaliclatinSansSerifNoBoldItalic'latinSansSerifNoBoldItaliclatinSansSerifBoldNoItalic'latinSansSerifBoldNoItaliclatinSansSerifBoldItalic'latinSansSerifBoldItaliclatinSansSerifBold'latinSansSerifBoldlatinSansSerifNoBold'latinSansSerifNoBoldlatinSansSerifItalic'latinSansSerifItaliclatinSansSerifNoItalic'latinSansSerifNoItalic sansSerif sansSerif'sansSerifItalic'sansSerifItalicsansSerifNoItalic'sansSerifNoItalicsansSerifBold' sansSerifBoldsansSerifNoBold'sansSerifNoBoldsansSerifNoBoldNoItalic'sansSerifNoBoldNoItalicsansSerifNoBoldItalic'sansSerifNoBoldItalicsansSerifBoldNoItalic'sansSerifBoldNoItalicsansSerifBoldItalic'sansSerifBoldItalicscriptRegular' scriptRegularscriptBold' scriptBoldscript'scriptcalligraphyRegular'calligraphyRegularcalligraphyBold'calligraphyBoldcalligraphy'calligraphydigitSerif' digitSerifdigitSerifRegular'digitSerifRegulardigitSerifBold'digitSerifBoldintToDigitSerifRegular'intToDigitSerifRegularintToDigitSerifBold'intToDigitSerifBoldintToDigitSerif'intToDigitSerif greekSerifgreekSerif'greekSerifNoBoldNoItalic'greekSerifNoBoldNoItalicgreekSerifNoBoldItalic'greekSerifNoBoldItalicgreekSerifBoldNoItalic'greekSerifBoldNoItalicgreekSerifBoldItalic'greekSerifBoldItalicgreekSerifBold'greekSerifBoldgreekSerifNoBold'greekSerifNoBoldgreekSerifItalic'greekSerifItalicgreekSerifNoItalic'greekSerifNoItalic latinSeriflatinSerif'latinSerifNoBoldNoItalic'latinSerifNoBoldNoItaliclatinSerifNoBoldItalic'latinSerifNoBoldItaliclatinSerifBoldNoItalic'latinSerifBoldNoItaliclatinSerifBoldItalic'latinSerifBoldItaliclatinSerifBold'latinSerifBoldlatinSerifNoBold'latinSerifNoBoldlatinSerifItalic'latinSerifItaliclatinSerifNoItalic'latinSerifNoItalicserifserif'serifNoItalic' serifNoItalicserifItalic'serifItalic serifBold' serifBoldserifNoBold'serifNoBoldserifNoBoldNoItalic'serifNoBoldNoItalicserifNoBoldItalic'serifNoBoldItalicserifBoldNoItalic'serifBoldNoItalicserifBoldItalic'serifBoldItalicmath'math mathAlpha' mathAlpha latinMathdigit'digitintToDigitChar'intToDigitCharchar10char11duodecimalDigit'duodecimalDigitduodecimalNumberduodecimalNumber'singleStroke singleStroke1 singleStroke2 singleStroke3 singleStroke4 singleStroke5singleStroke5' singleStroke6 singleStroke7 singleStroke8 singleStroke9cattleHobble cattleHobble1 cattleHobble2cattleHobble2' cattleHobble3cattleHobble3' cattleHobble4cattleHobble4' cattleHobble5cattleHobble5' cattleHobble6 cattleHobble7 cattleHobble8 cattleHobble9 coilOfRopecoilOfRope1coilOfRope2coilOfRope3coilOfRope4coilOfRope5coilOfRope5'coilOfRope6coilOfRope7coilOfRope8coilOfRope9 waterLily waterLily1 waterLily2 waterLily3 waterLily4 waterLily5 waterLily6 waterLily7 waterLily8 waterLily9 bentFingerbentFinger1bentFinger2bentFinger3bentFinger4bentFinger5bentFinger5'bentFinger6bentFinger7bentFinger8bentFinger9tadpolehehnfrplusminusegyptianNumberegyptianNumber'egyptianNumber''RomanLiteralVIIVIIIIXXXIXIILCDM RomanStyleAdditiveSubtractive toLiteralsromanLiteral romanLiteral'romanNumeral romanNumeral'romanNumeralCaseromanNumberromanNumber'romanNumberCase$fDefaultRomanStyle$fArbitraryRomanStyle$fUnicodeTextRomanLiteral$fUnicodeCharacterRomanLiteral$fArbitraryRomanLiteral$fBoundedRomanLiteral$fEnumRomanLiteral$fEqRomanLiteral$fShowRomanLiteral$fReadRomanLiteral$fBoundedRomanStyle$fEnumRomanStyle$fEqRomanStyle$fShowRomanStyle$fReadRomanStylesegmentedDigit'segmentedDigitprivateStartprivateStop isPrivateCharprivateCharGenKlingonChEGhHJNNgPQQUpperRSTTlhUWYGlottalStopZeroOneTwoThreeFourFiveSixSevenEightNineCommaFullStop Mummification$fUnicodeTextKlingon$fUnicodeCharacterKlingon$fArbitraryKlingon$fBoundedKlingon $fEnumKlingon$fEqKlingon$fOrdKlingon $fReadKlingon $fShowKlingontoSuptoSubratioToUnicoderatioToUnicode'asSupasSup' asSupPlusasSubasSub' asSubPlusghc-prim GHC.TypesCharcontainers-0.6.2.1Data.Map.InternalMap GHC.MaybeJustNothingTrueFalsetext-1.2.3.2Data.Text.InternalText1data-default-class-0.1.2.0-IIN1s3V8yfYEDHe5yjxXHVData.Default.ClassdefDefaultGHC.EnumEnumfromEnumminBoundmaxBoundGHC.RealIntegralBoolMaybe_dispatchLatinGreekDigit'_dispatchLatinGreekDigit_shiftC_ordc_baseUpperLower_baseUpperLowerNum_isValidInt_withCondition(QuickCheck-2.14.2-9AhRAvZYUVyKu9RkvnejmbTest.QuickCheck.GenGenRatio